Property Summary

NCBI Gene PubMed Count 25
PubMed Score 5.93
PubTator Score 5.19

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (21)

Disease log2 FC p
Rheumatoid Arthritis -1.700 1.8e-02
astrocytic glioma -1.800 2.0e-02
permanent atrial fibrillation -1.400 1.3e-02
glioblastoma -1.800 3.0e-05
oligodendroglioma -1.600 1.6e-09
osteosarcoma -2.730 3.5e-04
posterior fossa group B ependymoma 1.600 5.5e-08
sonic hedgehog group medulloblastoma -2.400 1.9e-06
cystic fibrosis -1.016 4.3e-04
atypical teratoid/rhabdoid tumor -1.600 5.7e-04
primitive neuroectodermal tumor -1.100 2.5e-02
primary pancreatic ductal adenocarcinoma 1.059 1.8e-02
intraductal papillary-mucinous neoplasm ... 2.300 1.4e-02
lung cancer 1.500 2.6e-04
interstitial cystitis -1.600 4.9e-03
pediatric high grade glioma -1.900 7.6e-04
pilocytic astrocytoma -1.800 8.5e-06
Pick disease -1.200 3.4e-02
ductal carcinoma in situ 1.700 3.3e-02
ovarian cancer 2.400 1.5e-04
chronic rhinosinusitis -1.302 4.9e-02

Gene RIF (6)

PMID Text
24807905 NME7 functions in the gamma-tubulin ring complex in a kinase-dependent manner to facilitate microtubule nucleation.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19536175 Observational study of gene-disease association. (HuGE Navigator)
19240061 Observational study of gene-disease association. (HuGE Navigator)
19064610 Observational study of gene-disease association. (HuGE Navigator)
17363702 Compared with wild-type betagamma nucleoside diphosphate kinase overexpression of Gbeta nucleoside diphosphate kinase suppressed basal cAMP formation up to 55%.

AA Sequence

MNHSERFVFIAEWYDPNASLLRRYELLFYPGDGSVEMHDVKNHRTFLKRTKYDNLHLEDLFIGNKVNVFS      1 - 70
RQLVLIDYGDQYTARQLGSRKEKTLALIKPDAISKAGEIIEIINKAGFTITKLKMMMLSRKEALDFHVDH     71 - 140
QSRPFFNELIQFITTGPIIAMEILRDDAICEWKRLLGPANSGVARTDASESIRALFGTDGIRNAAHGPDS    141 - 210
FASAAREMELFFPSSGGCGPANTAKFTNCTCCIVKPHAVSEGLLGKILMAIRDAGFEISAMQMFNMDRVN    211 - 280
VEEFYEVYKGVVTEYHDMVTEMYSGPCVAMEIQQNNATKTFREFCGPADPEIARHLRPGTLRAIFGKTKI    281 - 350
QNAVHCTDLPEDGLLEVQYFFKILDN                                                351 - 376
//

Text Mined References (26)

PMID Year Title
27173435 2016 An organelle-specific protein landscape identifies novel diseases and molecular mechanisms.
27107012 2016 Pooled-matrix protein interaction screens using Barcode Fusion Genetics.
26638075 2015 A Dynamic Protein Interaction Landscape of the Human Centrosome-Cilium Interface.
25416956 2014 A proteome-scale map of the human interactome network.
24952745 2014 Genetic association study of QT interval highlights role for calcium signaling pathways in myocardial repolarization.
24807905 2014 NME7 is a functional component of the ?-tubulin ring complex.
22672568 2012 A genome-wide association study of venous thromboembolism identifies risk variants in chromosomes 1q24.2 and 9q.
21988832 2011 Toward an understanding of the protein interaction network of the human liver.
21980494 2011 Genetics of venous thrombosis: insights from a new genome wide association study.
21516116 2011 Next-generation sequencing to generate interactome datasets.
21502573 2011 Genetic predictors of fibrin D-dimer levels in healthy adults.
21399614 2011 Novel asymmetrically localizing components of human centrosomes identified by complementary proteomics methods.
21269460 2011 Initial characterization of the human central proteome.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19852809 2009 Nme protein family evolutionary history, a vertebrate perspective.
19536175 2009 Follow-up of a major linkage peak on chromosome 1 reveals suggestive QTLs associated with essential hypertension: GenNet study.
19240061 2009 Coeliac disease-associated risk variants in TNFAIP3 and REL implicate altered NF-kappaB signalling.
19064610 2009 Pre-B-cell leukemia homeobox 1 (PBX1) shows functional and possible genetic association with bone mineral density variation.
17363702 2007 Regulation of cardiac cAMP synthesis and contractility by nucleoside diphosphate kinase B/G protein beta gamma dimer complexes.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11768308 2000 The human Nm23/nucleoside diphosphate kinases.
11329013 2001 Creation of genome-wide protein expression libraries using random activation of gene expression.