Property Summary

NCBI Gene PubMed Count 9
PubMed Score 6.16
PubTator Score 5.90

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
posterior fossa group A ependymoma 1.400 2.6e-12
glioblastoma 1.100 4.5e-05
primitive neuroectodermal tumor 1.200 1.5e-04
pediatric high grade glioma 1.200 4.2e-08
group 3 medulloblastoma 1.300 1.9e-04
Pick disease 1.100 2.9e-04

Gene RIF (2)

PMID Text
25496667 Genome-wide shRNA screening identifies NME6, which is required for HIV-1 Nef-induced downregulation of CD4 in HeLa CD4+ cells
20877624 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MASILRSPQALQLTLALIKPDAVAHPLILEAVHQQILSNKFLIVRMRELLWRKEDCQRFYREHEGRFFYQ      1 - 70
RLVEFMASGPIRAYILAHKDAIQLWRTLMGPTRVFRARHVAPDSIRGSFGLTDTRNTTHGSDSVVSASRE     71 - 140
IAAFFPDFSEQRWYEEEEPQLRCGPVCYSPEGGVHYVAGTGGLGPA                            141 - 186
//

Text Mined References (13)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
21269460 2011 Initial characterization of the human central proteome.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
19852809 2009 Nme protein family evolutionary history, a vertebrate perspective.
16641997 2006 The DNA sequence, annotation and analysis of human chromosome 3.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10618642 1999 A novel human nucleoside diphosphate (NDP) kinase, Nm23-H6, localizes in mitochondria and affects cytokinesis.
10453732 1999 NME6: a new member of the nm23/nucleoside diphosphate kinase gene family located on human chromosome 3p21.3.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.