Property Summary

NCBI Gene PubMed Count 11
PubMed Score 6.37
PubTator Score 6.33

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Disease log2 FC p
active Crohn's disease 1.399 1.7e-02
active ulcerative colitis 1.211 2.5e-02
adult high grade glioma -1.200 8.6e-03
astrocytic glioma -1.400 1.3e-02
colon cancer 1.800 1.2e-02
ependymoma 1.400 2.6e-06
glioblastoma -1.100 2.0e-02
group 3 medulloblastoma -1.400 4.1e-02
interstitial cystitis -1.200 1.2e-04
lung adenocarcinoma -1.300 1.1e-08
lung carcinoma 1.100 1.9e-03
medulloblastoma, large-cell -2.500 4.1e-04
nasopharyngeal carcinoma -1.900 6.5e-07
non-small cell lung cancer -1.393 3.2e-09
oligodendroglioma -1.200 2.3e-09
osteosarcoma -1.183 4.2e-02
ovarian cancer 1.300 5.8e-04

Gene RIF (2)

AA Sequence

MEISMPPPQIYVEKTLAIIKPDIVDKEEEIQDIILRSGFTIVQRRKLRLSPEQCSNFYVEKYGKMFFPNL      1 - 70
TAYMSSGPLVAMILARHKAISYWLELLGPNNSLVAKETHPDSLRAIYGTDDLRNALHGSNDFAAAEREIR     71 - 140
FMFPEVIVEPIPIGQAAKDYLNLHIMPTLLEGLTELCKQKPADPLIWLADWLLKNNPNKPKLCHHPIVEE    141 - 210
PY                                                                        211 - 212
//

Text Mined References (12)

PMID Year Title