Property Summary

NCBI Gene PubMed Count 23
PubMed Score 51.80
PubTator Score 67.25

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
malignant mesothelioma 1.200 9.3e-06
astrocytoma 1.100 6.8e-29
oligodendroglioma 1.100 3.7e-18
osteosarcoma -1.424 1.7e-05
glioblastoma 1.600 1.1e-04
atypical teratoid / rhabdoid tumor 2.000 4.8e-10
medulloblastoma, large-cell 1.100 1.3e-04
primary pancreatic ductal adenocarcinoma 1.007 2.9e-02
lung cancer 1.700 3.6e-05
pediatric high grade glioma 1.300 2.8e-04
non primary Sjogren syndrome sicca 1.100 3.6e-02
Breast cancer 1.200 5.7e-12
pituitary cancer 1.100 1.3e-04

Gene RIF (7)

PMID Text
25233933 miR-196 performed it's their function by inhibiting NME4 expression and further activating p-JNK, suppressing TIMP1, and augmenting MMP1/9.
25231795 Mitochondrial NM23-H4/NDPK-D: a bifunctional nanoswitch for bioenergetics and lipid signaling
25010650 NDPK-B and NDPK-D were shown to bind efficiently to liposomes mimicking plasma membrane and mitochondrial inner membrane
24970086 findings show NDPKs (NM23-H1/H2/H4) interact with and provide GTP to dynamins, allowing these motor proteins to work with high thermodynamic efficiency for membrane remodeling
23150663 Nm23-H4 acts as a lipid-dependent mitochondrial switch with dual function in phosphotransfer serving local GTP supply and cardiolipin transfer for apoptotic signaling and putative other functions
20877624 Observational study of gene-disease association. (HuGE Navigator)
18604718 High expression of ERCC1, FLT1, NME4 and PCNA in myelodysplastic syndrome was associated with poor prognosis and disease progression along the sequence of 5q-syndrome/RCMD/RAEB/de novo AML

AA Sequence

MGGLFWRSALRGLRCGPRAPGPSLLVRHGSGGPSWTRERTLVAVKPDGVQRRLVGDVIQRFERRGFTLVG      1 - 70
MKMLQAPESVLAEHYQDLRRKPFYPALIRYMSSGPVVAMVWEGYNVVRASRAMIGHTDSAEAAPGTIRGD     71 - 140
FSVHISRNVIHASDSVEGAQREIQLWFQSSELVSWADGGQHSSIHPA                           141 - 187
//

Text Mined References (25)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
25233933 2014 OncomiR-196 promotes an invasive phenotype in oral cancer through the NME4-JNK-TIMP1-MMP signaling pathway.
25231795 2015 Mitochondrial NM23-H4/NDPK-D: a bifunctional nanoswitch for bioenergetics and lipid signaling.
25010650 2014 Structural comparison of highly similar nucleoside-diphosphate kinases: Molecular explanation of distinct membrane-binding behavior.
24970086 2014 Membrane trafficking. Nucleoside diphosphate kinases fuel dynamin superfamily proteins with GTP for membrane remodeling.
23446634 2013 Genome-wide association analysis of red blood cell traits in African Americans: the COGENT Network.
23275563 2013 Development and application of a DNA microarray-based yeast two-hybrid system.
23150663 2013 Dual function of mitochondrial Nm23-H4 protein in phosphotransfer and intermembrane lipid transfer: a cardiolipin-dependent switch.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
19852809 2009 Nme protein family evolutionary history, a vertebrate perspective.
18635542 2008 The nucleoside diphosphate kinase D (NM23-H4) binds the inner mitochondrial membrane with high affinity to cardiolipin and couples nucleotide transfer with respiration.
18604718 2008 High expression of ERCC1, FLT1, NME4 and PCNA associated with poor prognosis and advanced stages in myelodysplastic syndrome.
17028143 2007 Novel lipid transfer property of two mitochondrial proteins that bridge the inner and outer membranes.
16712791 2006 Identification of intrahepatic cholangiocarcinoma related genes by comparison with normal liver tissues using expressed sequence tags.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15616553 2004 The sequence and analysis of duplication-rich human chromosome 16.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11831846 2002 Localization and characterization of the mitochondrial isoform of the nucleoside diphosphate kinase in the pancreatic beta cell: evidence for its complexation with mitochondrial succinyl-CoA synthetase.
11157797 2001 Sequence, structure and pathology of the fully annotated terminal 2 Mb of the short arm of human chromosome 16.
10799505 2000 The human nm23-H4 gene product is a mitochondrial nucleoside diphosphate kinase.
9099850 1997 nm23-H4, a new member of the family of human nm23/nucleoside diphosphate kinase genes localised on chromosome 16p13.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.