Property Summary

NCBI Gene PubMed Count 16
PubMed Score 55.35
PubTator Score 45.90

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
tuberculosis 1563 5.4e-07
ovarian cancer 8491 2.3e-06
psoriasis 6685 1.3e-04
medulloblastoma, large-cell 6234 5.9e-03

Expression

  Differential Expression (4)

Disease log2 FC p
psoriasis 1.800 1.3e-04
medulloblastoma, large-cell -1.100 5.9e-03
tuberculosis 1.200 5.4e-07
ovarian cancer 2.100 2.3e-06

Protein-protein Interaction (12)

Gene RIF (3)

PMID Text
23765094 Down-regulated DR-nm23 expression is associated with invasion and metastasis in colorectal cancer.
20877624 Observational study of gene-disease association. (HuGE Navigator)
17900511 Among genes correlated to nodal metastatic progression, we verified in vitro that NM23-H3 reduced cell motility.

AA Sequence

MICLVLTIFANLFPAACTGAHERTFLAVKPDGVQRRLVGEIVRRFERKGFKLVALKLVQASEELLREHYA      1 - 70
ELRERPFYGRLVKYMASGPVVAMVWQGLDVVRTSRALIGATNPADAPPGTIRGDFCIEVGKNLIHGSDSV     71 - 140
ESARREIALWFRADELLCWEDSAGHWLYE                                             141 - 169
//

Text Mined References (17)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
23765094 2013 Inhibitory effect of upregulated DR-nm23 expression on invasion and metastasis in colorectal cancer.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
21269460 2011 Initial characterization of the human central proteome.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
19852809 2009 Nme protein family evolutionary history, a vertebrate perspective.
17900511 2007 Molecular classification of nodal metastasis in primary larynx squamous cell carcinoma.
16713569 2006 A protein-protein interaction network for human inherited ataxias and disorders of Purkinje cell degeneration.
16537434 2006 p90 ribosomal S6 kinase 2 exerts a tonic brake on G protein-coupled receptor signaling.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11277919 2001 Structural and catalytic properties and homology modelling of the human nucleoside diphosphate kinase C, product of the DRnm23 gene.
11157797 2001 Sequence, structure and pathology of the fully annotated terminal 2 Mb of the short arm of human chromosome 16.
11042679 2000 Neuroblastoma specific effects of DR-nm23 and its mutant forms on differentiation and apoptosis.
9067290 1997 Gene structure, promoter activity, and chromosomal location of the DR-nm23 gene, a related member of the nm23 gene family.
7638209 1995 Overexpression of DR-nm23, a protein encoded by a member of the nm23 gene family, inhibits granulocyte differentiation and induces apoptosis in 32Dc13 myeloid cells.