Property Summary

Ligand Count 17
NCBI Gene PubMed Count 56
PubMed Score 43.96
PubTator Score 76.20

Knowledge Summary

Patent (4,261)


  Disease (4)

Disease Target Count Z-score Confidence
Breast Neoplasms 445 0.0 0.0
Disease Target Count
Mammary Neoplasms 425
Disease Target Count P-value
psoriasis 6694 2.5e-03
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6


  Differential Expression (1)

Disease log2 FC p
psoriasis -1.200 2.5e-03

Gene RIF (4)

AA Sequence

TSYLLSSSAVRMTSLKSNAKNMVTNSVLLNGHSMKQEMAL                                  351 - 390

Text Mined References (44)

PMID Year Title