Property Summary

NCBI Gene PubMed Count 29
PubMed Score 110.78
PubTator Score 139.68

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
malignant mesothelioma -1.500 6.0e-06
astrocytic glioma 2.800 3.1e-03
posterior fossa group A ependymoma 2.100 1.0e-11
oligodendroglioma 2.200 4.7e-03
glioblastoma 2.000 2.0e-03
atypical teratoid/rhabdoid tumor 1.700 3.5e-03
adrenocortical carcinoma -1.179 2.3e-05
breast carcinoma -1.700 5.5e-03
fibroadenoma -2.500 1.3e-02
adult high grade glioma 1.700 2.5e-03
pilocytic astrocytoma 1.600 9.0e-06
ductal carcinoma in situ -2.000 1.4e-03
invasive ductal carcinoma -2.100 6.5e-03
Breast cancer 1.200 1.3e-03

Gene RIF (12)

PMID Text
23879873 Rs2292462 was associated with left ventricular hypertrophy in type 2 diabetic patients.
21527296 There was no association between eating behaviour traits, or anthropometric variables, and NMB p.P73T polymorphism.
20010906 TT genotype of the NMB rs3809508 polymorphism was associated with a higher risk of obesity and moreover, the effects of this polymorphism on anthropometric values were influenced by the maternal educational level.
20010906 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
18271693 No significant differences in the genotype distribution were demonstrated between normal weight and overweight/obese subjects
18271693 Observational study of gene-disease association. (HuGE Navigator)
17766645 REsults describe the expression of neuromedin B in adipose tissue and its regulation by changes in energy balance.
17299381 Observational study of gene-disease association. (HuGE Navigator)
15585758 Associated with eating behaviors
15528253 NMB and its receptor are coexpressed by proliferating cells in which they act in an autocrine fashion with similar and modest potency in both normal and malignant colonic epithelial cells.
15158442 lysosomal degradation of neuromedin B is dependent on tripeptidyl peptidase-I
11194934 Observational study of genotype prevalence and gene-disease association. (HuGE Navigator)

AA Sequence

MARRAGGARMFGSLLLFALLAAGVAPLSWDLPEPRSRASKIRVHSRGNLWATGHFMGKKSLEPSSPSPLG      1 - 70
TAPHTSLRDQRLQLSHDLLGILLLKKALGVSLSRPAPQIQYRRLLVQILQK                        71 - 121
//

Text Mined References (30)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
25123163 2014 Itch-associated peptides: RNA-Seq and bioinformatic analysis of natriuretic precursor peptide B and gastrin releasing peptide in dorsal root and trigeminal ganglia, and the spinal cord.
24092425 2013 Anti-EGFR therapy combined with neuromedin B receptor blockade induces the death of DAOY medulloblastoma cells.
24054546 2013 Functional bombesin receptors in urinary tract of rats and human but not of pigs and mice, an in vitro study.
23879873 2013 Genetic variants predicting left ventricular hypertrophy in a diabetic population: a Go-DARTS study including meta-analysis.
23317790 2013 The role of bombesin and bombesin-related peptides in the short-term control of food intake.
21712056 2011 Bombesin receptor subtype-3 agonists stimulate the growth of lung cancer cells and increase EGF receptor tyrosine phosphorylation.
21527296 2011 Effects of neuromedin-? on caloric compensation, eating behaviours and habitual food intake.
21140465 Biochemical specificity of von Economo neurons in hominoids.
21140464 The von Economo neurons in apes and humans.
20010906 2010 Influence of maternal educational level on the association between the rs3809508 neuromedin B gene polymorphism and the risk of obesity in the HELENA study.
18271693 2008 Neuromedin beta: P73T polymorphism in overweight and obese subjects.
17766645 2007 Expression of neuromedin B in adipose tissue and its regulation by changes in energy balance.
17299381 2007 Contribution of several candidate gene polymorphisms in the determination of adiposity changes: results from the Québec Family Study.
16572171 2006 Analysis of the DNA sequence and duplication history of human chromosome 15.
15585758 2004 Neuromedin beta: a strong candidate gene linking eating behaviors and susceptibility to obesity.
15528253 2005 Neuromedin B and its receptor are mitogens in both normal and malignant epithelial cells lining the colon.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15158442 2004 The lysosomal degradation of neuromedin B is dependent on tripeptidyl peptidase-I: evidence for the impairment of neuropeptide degradation in late-infantile neuronal ceroid lipofuscinosis.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11194934 2000 Significant association between a silent polymorphism in the neuromedin B gene and body weight in German children and adolescents.
10544247 1999 Solution structure of neuromedin B by (1)H nuclear magnetic resonance spectroscopy.
8392057 1993 The fifth transmembrane segment of the neuromedin B receptor is critical for high affinity neuromedin B binding.
8253343 1993 Expression of bombesin-receptor subtypes and their differential regulation of colonic smooth muscle contraction.
7851890 1994 Regional localization of human chromosome 15 loci.
4041812 1985 Distribution and chromatographic characterization of neuromedin B-like immunoreactivity in the human spinal cord.
2458345 1988 Molecular cloning of cDNAs encoding the human bombesin-like peptide neuromedin B. Chromosomal localization and comparison to cDNAs encoding its amphibian homolog ranatensin.
1720612 1991 Bombesin, neuromedin B and neuromedin C interact with a common rat pancreatic phosphoinositide-coupled receptor, but are differentially regulated by guanine nucleotides.
1717141 1991 Production of neuromedin B and neuromedin B gene expression in human lung tumor cell lines.
1488105 1992 The presence, characterisation and synthesis of neuromedin B in the human pituitary gland.