Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
ovarian cancer 8520 2.9e-06

AA Sequence

MVSSAQLDFNLQALLGQLSQDDLCKFKSLIRTVSLGNELQKIPQT                               1 - 45
//

Text Mined References (3)

PMID Year Title