Property Summary

NCBI Gene PubMed Count 14
PubMed Score 7.46
PubTator Score 5.92

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count P-value
psoriasis 6694 7.7e-04
medulloblastoma, large-cell 6241 3.8e-03
group 3 medulloblastoma 4104 4.7e-03
glioblastoma 5792 4.8e-03
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 1.0
Kidney cancer 2613 0.0 0.7
Melanoma 711 0.0 0.5
Disease Target Count Z-score Confidence
Multiple Sclerosis 540 0.0 1.1
Disease Target Count Z-score Confidence
Necrotizing fasciitis 10 3.343 1.7

Expression

  Differential Expression (4)

Disease log2 FC p
glioblastoma 1.400 4.8e-03
group 3 medulloblastoma 1.300 4.7e-03
medulloblastoma, large-cell 1.400 3.8e-03
psoriasis -1.600 7.7e-04

Gene RIF (2)

AA Sequence

MAESDSTDFDLLWYLENLSDKEFQSFKKYLARKILDFKLPQFPLIQMTKEELANVLPISYEGQYIWNMLF      1 - 70
SIFSMMRKEDLCRKIIGRRNRNQEACKAVMRRKFMLQWESHTFGKFHYKFFRDVSSDVFYILQLAYDSTS     71 - 140
YYSANNLNVFLMGERASGKTIVINLAVLRWIKGEMWQNMISYVVHLTAHEINQMTNSSLAELIAKDWPDG    141 - 210
QAPIADILSDPKKLLFILEDLDNIRFELNVNESALCSNSTQKVPIPVLLVSLLKRKMAPGCWFLISSRPT    211 - 280
RGNNVKTFLKEVDCCTTLQLSNGKREIYFNSFFKDRQRASAALQLVHEDEILVGLCRVAILCWITCTVLK    281 - 350
RQMDKGRDFQLCCQTPTDLHAHFLADALTSEAGLTANQYHLGLLKRLCLLAAGGLFLSTLNFSGEDLRCV    351 - 420
GFTEADVSVLQAANILLPSNTHKDRYKFIHLNVQEFCTAIAFLMAVPNYLIPSGSREYKEKREQYSDFNQ    421 - 490
VFTFIFGLLNANRRKILETSFGYQLPMVDSFKWYSVGYMKHLDRDPEKLTHHMPLFYCLYENREEEFVKT    491 - 560
IVDALMEVTVYLQSDKDMMVSLYCLDYCCHLRTLKLSVQRIFQNKEPLIRPTASQMKSLVYWREICSLFY    561 - 630
TMESLRELHIFDNDLNGISERILSKALEHSSCKLRTLKLSYVSTASGFEDLLKALARNRSLTYLSINCTS    631 - 700
ISLNMFSLLHDILHEPTCQISHLSLMKCDLRASECEEIASLLISGGSLRKLTLSSNPLRSDGMNILCDAL    701 - 770
LHPNCTLISLVLVFCCLTENCCSALGRVLLFSPTLRQLDLCVNRLKNYGVLHVTFPLLFPTCQLEELHLS    771 - 840
GCFFSSDICQYIAIVIATNEKLRSLEIGSNKIEDAGMQLLCGGLRHPNCMLVNIGLEECMLTSACCRSLA    841 - 910
SVLTTNKTLERLNLLQNHLGNDGVAKLLESLISPDCVLKVVGLPLTGLNTQTQQLLMTVKERKPSLIFLS    911 - 980
ETWSLKEGREIGVTPASQPGSIIPNSNLDYMFFKFPRMSAAMRTSNTASRQPL                     981 - 1033
//

Text Mined References (15)

PMID Year Title