Property Summary

NCBI Gene PubMed Count 14
PubMed Score 6.75
PubTator Score 5.92

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count
Menopause present (finding) 20
Disease Target Count P-value
psoriasis 6685 7.7e-04
medulloblastoma 1524 1.8e-03
medulloblastoma, large-cell 6234 3.8e-03
glioblastoma 5572 4.8e-03
Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0
Disease Target Count Z-score Confidence
Multiple Sclerosis 498 0.0 1.0
Disease Target Count Z-score Confidence
Necrotizing fasciitis 9 3.398 1.7

Expression

  Differential Expression (4)

Disease log2 FC p
medulloblastoma 1.700 1.8e-03
glioblastoma 1.400 4.8e-03
medulloblastoma, large-cell 1.400 3.8e-03
psoriasis -1.600 7.7e-04

Gene RIF (2)

PMID Text
20403135 Observational study of gene-disease association. (HuGE Navigator)
19074885 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MAESDSTDFDLLWYLENLSDKEFQSFKKYLARKILDFKLPQFPLIQMTKEELANVLPISYEGQYIWNMLF      1 - 70
SIFSMMRKEDLCRKIIGRRNRNQEACKAVMRRKFMLQWESHTFGKFHYKFFRDVSSDVFYILQLAYDSTS     71 - 140
YYSANNLNVFLMGERASGKTIVINLAVLRWIKGEMWQNMISYVVHLTAHEINQMTNSSLAELIAKDWPDG    141 - 210
QAPIADILSDPKKLLFILEDLDNIRFELNVNESALCSNSTQKVPIPVLLVSLLKRKMAPGCWFLISSRPT    211 - 280
RGNNVKTFLKEVDCCTTLQLSNGKREIYFNSFFKDRQRASAALQLVHEDEILVGLCRVAILCWITCTVLK    281 - 350
RQMDKGRDFQLCCQTPTDLHAHFLADALTSEAGLTANQYHLGLLKRLCLLAAGGLFLSTLNFSGEDLRCV    351 - 420
GFTEADVSVLQAANILLPSNTHKDRYKFIHLNVQEFCTAIAFLMAVPNYLIPSGSREYKEKREQYSDFNQ    421 - 490
VFTFIFGLLNANRRKILETSFGYQLPMVDSFKWYSVGYMKHLDRDPEKLTHHMPLFYCLYENREEEFVKT    491 - 560
IVDALMEVTVYLQSDKDMMVSLYCLDYCCHLRTLKLSVQRIFQNKEPLIRPTASQMKSLVYWREICSLFY    561 - 630
TMESLRELHIFDNDLNGISERILSKALEHSSCKLRTLKLSYVSTASGFEDLLKALARNRSLTYLSINCTS    631 - 700
ISLNMFSLLHDILHEPTCQISHLSLMKCDLRASECEEIASLLISGGSLRKLTLSSNPLRSDGMNILCDAL    701 - 770
LHPNCTLISLVLVFCCLTENCCSALGRVLLFSPTLRQLDLCVNRLKNYGVLHVTFPLLFPTCQLEELHLS    771 - 840
GCFFSSDICQYIAIVIATNEKLRSLEIGSNKIEDAGMQLLCGGLRHPNCMLVNIGLEECMLTSACCRSLA    841 - 910
SVLTTNKTLERLNLLQNHLGNDGVAKLLESLISPDCVLKVVGLPLTGLNTQTQQLLMTVKERKPSLIFLS    911 - 980
ETWSLKEGREIGVTPASQPGSIIPNSNLDYMFFKFPRMSAAMRTSNTASRQPL                     981 - 1033
//

Text Mined References (15)

PMID Year Title
23377640 2013 Common genetic variation and antidepressant efficacy in major depressive disorder: a meta-analysis of three genome-wide pharmacogenetic studies.
23307926 2013 A genome-wide association study of early menopause and the combined impact of identified variants.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
22267201 2012 Meta-analyses identify 13 loci associated with age at menopause and highlight DNA repair and immune pathways.
20403135 2010 The genetics of NOD-like receptors in Crohn's disease.
19074885 2008 Genetic variants in apoptosis and immunoregulation-related genes are associated with risk of chronic lymphocytic leukemia.
19010793 2009 Genome-wide association analysis of susceptibility and clinical phenotype in multiple sclerosis.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15057824 2004 The DNA sequence and biology of human chromosome 19.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12615073 2003 Regulation of cryopyrin/Pypaf1 signaling by pyrin, the familial Mediterranean fever gene product.
12563287 2003 NALPs: a novel protein family involved in inflammation.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12387869 2002 Functional screening of five PYPAF family members identifies PYPAF5 as a novel regulator of NF-kappaB and caspase-1.
12019269 2002 PYPAF7, a novel PYRIN-containing Apaf1-like protein that regulates activation of NF-kappa B and caspase-1-dependent cytokine processing.