Property Summary

NCBI Gene PubMed Count 89
PubMed Score 103.91
PubTator Score 102.03

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
malignant mesothelioma -2.400 3.9e-08
psoriasis -1.200 1.7e-06
osteosarcoma -2.147 2.8e-05
medulloblastoma -1.400 6.2e-05
cystic fibrosis -1.332 6.1e-06
atypical teratoid / rhabdoid tumor 1.400 6.2e-03
glioblastoma 1.300 5.9e-03
medulloblastoma, large-cell -4.000 1.5e-05
non-small cell lung cancer -1.127 2.6e-10
intraductal papillary-mucinous carcinoma... -1.400 3.9e-02
lung cancer -1.100 8.8e-04
adult high grade glioma 1.400 6.6e-03
subependymal giant cell astrocytoma 1.136 1.8e-02
non-inflammatory breast cancer -1.800 1.3e-03
lung carcinoma -1.100 5.9e-20
ovarian cancer -3.100 2.6e-12

MLP Assay (4)

AID Type Active / Inconclusive / Inactive Description
2071 screening 1717 / 0 / 278431 Colorimetric Assay for Inhibitors for NALP1
2092 summary 0 / 0 / 0 Summary Assay for Inhibitors for NALP1
488841 screening 380 / 0 / 994 Single concentration confirmation of uHTS for the identification of inhibitors of NALP1 in yeast using a luminescent assay
488860 confirmatory 29 / 0 / 12 Dose Response confirmation of uHTS for the identification of inhibitors of NALP1 in yeast using a luminescent assay

Gene RIF (77)

PMID Text
26939933 The NLRP3 and NLRP1 inflammasomes are activated in Alzheimer's disease
26715049 NLRP1 inflammasome is activated by extracellular acidosis through ASIC1a signal pathway.
26232934 Nlrp1 inflammasome is downregulated in trauma patients
26079697 Ethanol-induced HMGB1 release is associated with NOX2/NLRP1 inflammasome signaling, which represents a novel mechanism of ethanol-associated neuron injury.
25814374 Letter: aspirin intake in peripheral arterial disease attenuates NLRP1 inflammasome gene expression in endothelial cells.
25744023 Human central Nervous System neurons express NLRP1 inflammasomes, which activate Casp1 and subsequently Casp6. Casp1 activation generates interleukin-1-beta-mediated neuroinflammation and Casp6 activation causes axonal degeneration.
25725098 these data identify NLRP1 as an essential mediator of the host immune response during IBD and cancer.
25626361 The data of this study suggested that NLRP1/caspase-1 signaling participates in the seizure-induced degenerative process in humans.
25611377 NALP1 is expressed low in colon cancer and associated with the survival and tumor metastasis of patients, and treatment with 5-aza-2-deoxycytidine can restore NALP1 levels to suppress the growth of colon cancer.
25556596 The NLRP1 variant rs12150220 (L155H) was associated with the development of preeclampsia (OR = 1.58), suggesting a role of this inflammasome receptor in the pathogenesis of this multifactorial disorder.
25342284 Elevated expression of NLRP1 was associated with pemphigus vulgaris disease progression.
25064844 The crystal structure of the LRR domain of human NLRP1 in the absence of muramyl dipeptide.
24909542 Our data support the involvement of NLRP1 and the NLRP1 inflammasome in psoriasis susceptibility and further support the role of innate immunity in psoriasis.
24699513 The NOD-like receptor NLRP1a/Caspase-1 pathway is the best candidate to mediate the parasite-induced cell death.
24439873 Inflammatory plasma factors induce NLRP1 on endothelial cells in peripheral artery disease.
24334646 These results indicated deregulation of NLRP3/NLRP1 inflammasomes in patients with systemic lupus erythematosus, and suggested an important role for inflammasomes in the pathogenesis and progression of systemic lupus erythematosus.
24065540 TNF-alpha rs1800629 A/G, NLRP1 rs878329 C/G and NLRP1 rs6502867 C/T polymorphisms were not associated with risk of RA or AS.
24008734 the NLRP1 and NLRP3 inflammasomes have a major role in neuronal cell death and behavioral deficits in stroke.
23940760 Stimulation with TNF-alpha is sufficient for activation of the NALP1 inflammasome.
23773036 Results show that polymorphisms in NLRP1 may be risk factors for susceptibility and progression of vitiligo.The upregulation of NLRP1 mRNA in patients with susceptible genotypes advocates the crucial role of NLRP1 in vitiligo.
23770116 Studied NLRP1 haplotypes associated with leprosy in Brazilian patients.
23563199 Genetic variation in the inflammasome affects atopic dermatitis susceptibility.
23508996 The charge surface of the NLRP1 CARD structure and a procaspase-1 CARD model suggests potential mechanisms for their association through electrostatic attraction.
23382179 NLRP1 RNA and protein levels were not altered by the predominant high-risk haplotype, indicating that altered function of the corresponding multivariant NLRP1 polypeptide predisposes to autoimmune diseases by activation of the NLRP1 inflammasome
23380025 Our results do not support the role of the NLRP1 rs8182352 in systemic sclerosis.
23374100 study found that NLRP1 rs12150220 T allele and NLRP1 rs2670660 G allele were significantly associated with autoimmune thyroid disorders compared with controls; NLRP1 may be involved in the pathogenesis of autoimmune thyroid disorders
23349227 We describe a new corneal intraepithelial dyskeratosis and how we identified its causative gene - NLRP1
23253924 NLRP1 shows a genetic association with giant cell arteritis.
23053059 we performed a genetic association study in patients with pneumococcal meningitis and found that single-nucleotide polymorphisms in the inflammasome genes CARD8 and NLRP1 are associated with poor disease outcome.
22665479 Autolytic proteolysis within the function to find domain (FIIND) is required for NLRP1 inflammasome activity.
22524199 NLRP3/NLRP1 polymorphisms are associated with melanoma susceptibility
22507623 A haplotype, T-T-C-G-A-C, in the NLRP1 gene was associated with a higher risk for Kawasaki disease development.
22235789 results demonstrated that NLRP1 rs2670660 SNP and the NLRP1 rs12150220-rs2670660 A-G haplotype were associated with systemic lupus erythematosus in our study population, and in particular with the development of nephritis, rash and arthritis
22227487 Twelve single nucleotide polymorphisms within NLRP1, NLRP3, NLRC4, CARD8, CASP1, and IL1B genes were analyzed in 150 HIV-1-infected Brazilian subjects. 2 polymorphisms in NLRP3 and IL1B were significantly associated to the HIV-1 infection.
22117610 Polymorphisms in the innate immunity gene NLRP1 are implicated in some familial forms of vitiligo. Review.
22087307 results identify a function for the FIIND and show that CARD8 and NLRP1 are ZU5-UPA domain-containing autoproteolytic proteins, thus suggesting a novel mechanism for regulating innate immune responses
21976003 NLRP1 is associated with rheumatoid arthritis in Han Chinese.
21946017 These findings provide evidence of an association between single nucleotide variations in the NLRP1 gene and Alzheimer disease
21376416 No evidence for association of the polymorphisms in NLRP1 gene with type 1 diabetes in Poland
21331694 None of the six SNPs in the NLRP1 region were significantly associated with disease susceptibility or the ocular, neurological, and dermatological manifestations of VKH.
21252346 study found KSHV Orf63 is a viral homolog of NLRP1; Orf63 blocked NLRP1-dependent innate immune responses; during the course of evolution with its human host, KSHV has usurped and modified a cellular NLR gene to inhibit the host inflammasome response
21245836 NALP1/NLRP1 inflammasomes may have a role in CD pathogenesis.
21149496 results establish NLRP1 as a new genetic susceptibility factor for systemic sclerosis-related pulmonary fibrosis and anti-topoisomerase-positive SSc phenotypes and provides new insights into the pathogenesis of SSc.
21098108 These findings suggest that the NALP1 inflammasome is critical for mediating innate immune responses to T. gondii infection and pathogenesis.
20800603 Observational study of gene-disease association. (HuGE Navigator)
20697295 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20574744 study found that 2 SNPs in the NALP1 extended promoter region, rs1008588 and rs2670660 were significantly associated with generalized vitiligo in Arab vitiligo patients; several other SNPs in the NALP1 region were at the margin of significant association
20574744 Observational study of gene-disease association. (HuGE Navigator)
20502346 Observational study of gene-disease association. (HuGE Navigator)
20403135 Observational study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20370570 Observational study of gene-disease association. (HuGE Navigator)
20152874 study confirms an association between the coding polymorphism in NLRP1 and Autoimmune Addison's disease
20152874 Observational study of gene-disease association. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19727120 three-way interaction effects of chromosome 7 SNP rs6960920, chromosome 9 SNP rs4744411, and NLRP1 SNP rs6502867 on vitiligo phenotype and autoimmune disease phenotype; effects of both chromosome 7 and NLRP1 SNP rs6502867 on the vitiligo phenotype
19727120 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19223160 gene polymorphism is associated with vitiligo
19120479 Genetic variations are associated with autoinflammatory disorders and increased susceptibility to microbial infection
19074885 Observational study of gene-disease association. (HuGE Navigator)
19001869 significant KPNA1-, NLRP1- and NLRP3-gene expression phenotypes associated with human genotypes of Crohn's disease, Huntington's disease and rheumatoid arthritis
18946481 NALP1 and the innate immune system may be implicated in the pathogenesis of many autoimmune disorders, particularly organ-specific autoimmune diseases.
18946481 Observational study of gene-disease association. (HuGE Navigator)
18854154 Knockdown of NLR family, pyrin domain containing 1 (NLRP1) by siRNA inhibits the early stages of HIV-1 replication in 293T cells infected with VSV-G pseudotyped HIV-1
18348116 The pyrin domain of the ASC and NALP1 proteins were simulated at two different pH values, 3.7 and 6.5, with two different force-field parameter sets, and the molecular dynamics simulation trajectories were compared to NMR experimental data
18263805 Relative copy numbers for the inflammasome mRNAs for ASC, caspase-1, NALP1, and Pypaf-7 were significantly lower in patients with septic shock compared with critically ill control subjects.
17637824 Observational study of gene-disease association. (HuGE Navigator)
17637824 NALP1 genetic variations are involved in predisposition to generalized vitiligo.
17620097 Observational study of gene-disease association. (HuGE Navigator)
17418785 Antiapoptotic proteins Bcl-2 and Bcl-X(L) bind and suppress NALP1, reducing caspase-1 activation and interleukin-1beta (IL-1beta) production.
17377159 DNA sequence variants in the NALP1 region are associated with the risk of several epidemiologically associated autoimmune and autoinflammatory diseases, implicating the innate immune system in the pathogenesis of these disorders.
17164409 NALP 1 and 3 show distinct but separate expression profiles in human tissues suggesting a site-specific role in the inflammatory response
15749123 Upregulation of apoptosis genes such as caspase 1, NALP1, and TNF receptor-associated factor 5 are induced by HIV-gp120/ethanol in human neurons
15212762 Over-expression of NALP1 stimulated cell death in both HeLa cells and cerebellar granule neurons.
14691733 Related to susceptiblity to vitiligo and autoimmune diseases.
12191486 inflammasome comprises caspase-1, caspase-5, Pycard/Asc, and NALP1; a molecular platform triggering activation of inflammatory caspases and processing of proIL-beta

AA Sequence

MAGGAWGRLACYLEFLKKEELKEFQLLLANKAHSRSSSGETPAQPEKTSGMEVASYLVAQYGEQRAWDLA      1 - 70
LHTWEQMGLRSLCAQAQEGAGHSPSFPYSPSEPHLGSPSQPTSTAVLMPWIHELPAGCTQGSERRVLRQL     71 - 140
PDTSGRRWREISASLLYQALPSSPDHESPSQESPNAPTSTAVLGSWGSPPQPSLAPREQEAPGTQWPLDE    141 - 210
TSGIYYTEIREREREKSEKGRPPWAAVVGTPPQAHTSLQPHHHPWEPSVRESLCSTWPWKNEDFNQKFTQ    211 - 280
LLLLQRPHPRSQDPLVKRSWPDYVEENRGHLIEIRDLFGPGLDTQEPRIVILQGAAGIGKSTLARQVKEA    281 - 350
WGRGQLYGDRFQHVFYFSCRELAQSKVVSLAELIGKDGTATPAPIRQILSRPERLLFILDGVDEPGWVLQ    351 - 420
EPSSELCLHWSQPQPADALLGSLLGKTILPEASFLITARTTALQNLIPSLEQARWVEVLGFSESSRKEYF    421 - 490
YRYFTDERQAIRAFRLVKSNKELWALCLVPWVSWLACTCLMQQMKRKEKLTLTSKTTTTLCLHYLAQALQ    491 - 560
AQPLGPQLRDLCSLAAEGIWQKKTLFSPDDLRKHGLDGAIISTFLKMGILQEHPIPLSYSFIHLCFQEFF    561 - 630
AAMSYVLEDEKGRGKHSNCIIDLEKTLEAYGIHGLFGASTTRFLLGLLSDEGEREMENIFHCRLSQGRNL    631 - 700
MQWVPSLQLLLQPHSLESLHCLYETRNKTFLTQVMAHFEEMGMCVETDMELLVCTFCIKFSRHVKKLQLI    701 - 770
EGRQHRSTWSPTMVVLFRWVPVTDAYWQILFSVLKVTRNLKELDLSGNSLSHSAVKSLCKTLRRPRCLLE    771 - 840
TLRLAGCGLTAEDCKDLAFGLRANQTLTELDLSFNVLTDAGAKHLCQRLRQPSCKLQRLQLVSCGLTSDC    841 - 910
CQDLASVLSASPSLKELDLQQNNLDDVGVRLLCEGLRHPACKLIRLGLDQTTLSDEMRQELRALEQEKPQ    911 - 980
LLIFSRRKPSVMTPTEGLDTGEMSNSTSSLKRQRLGSERAASHVAQANLKLLDVSKIFPIAEIAEESSPE    981 - 1050
VVPVELLCVPSPASQGDLHTKPLGTDDDFWGPTGPVATEVVDKEKNLYRVHFPVAGSYRWPNTGLCFVMR   1051 - 1120
EAVTVEIEFCVWDQFLGEINPQHSWMVAGPLLDIKAEPGAVEAVHLPHFVALQGGHVDTSLFQMAHFKEE   1121 - 1190
GMLLEKPARVELHHIVLENPSFSPLGVLLKMIHNALRFIPVTSVVLLYHRVHPEEVTFHLYLIPSDCSIR   1191 - 1260
KAIDDLEMKFQFVRIHKPPPLTPLYMGCRYTVSGSGSGMLEILPKELELCYRSPGEDQLFSEFYVGHLGS   1261 - 1330
GIRLQVKDKKDETLVWEALVKPGDLMPATTLIPPARIAVPSPLDAPQLLHFVDQYREQLIARVTSVEVVL   1331 - 1400
DKLHGQVLSQEQYERVLAENTRPSQMRKLFSLSQSWDRKCKDGLYQALKETHPHLIMELWEKGSKKGLLP   1401 - 1470
LSS                                                                      1471 - 1473
//

Text Mined References (99)

PMID Year Title
26939933 2016 The NLRP3 and NLRP1 inflammasomes are activated in Alzheimer's disease.
26715049 2015 Acid-sensing ion channel 1a contributes to the effect of extracellular acidosis on NLRP1 inflammasome activation in cortical neurons.
26347139 2015 TRIM-mediated precision autophagy targets cytoplasmic regulators of innate immunity.
26232934 2015 Nlrp1 inflammasome is downregulated in trauma patients.
26086088 2015 Transcription Factor ATF4 Induces NLRP1 Inflammasome Expression during Endoplasmic Reticulum Stress.
26079697 2015 Ethanol directly induced HMGB1 release through NOX2/NLRP1 inflammasome in neuronal cells.
25814374 2015 Aspirin therapy inhibits NLRP1 (nucleotide-binding domain-like receptor protein 1) inflammasome gene expression in patients with peripheral artery disease.
25744023 2015 Neuronal NLRP1 inflammasome activation of Caspase-1 coordinately regulates inflammatory interleukin-1-beta production and axonal degeneration-associated Caspase-6 activation.
25725098 2015 The NLRP1 inflammasome attenuates colitis and colitis-associated tumorigenesis.
25626361 2015 NLRP1 inflammasome is activated in patients with medial temporal lobe epilepsy and contributes to neuronal pyroptosis in amygdala kindling-induced rat model.
25611377 2015 DAC can restore expression of NALP1 to suppress tumor growth in colon cancer.
25556596 2015 NLRP1 L155H Polymorphism is a Risk Factor for Preeclampsia Development.
25342284 2015 Elevated expression of NLRP1 and IPAF are related to oral pemphigus vulgaris pathogenesis.
25064844 2014 Crystal structure of the leucine-rich repeat domain of the NOD-like receptor NLRP1: implications for binding of muramyl dipeptide.
24909542 2014 Genetic variations of NLRP1: susceptibility in psoriasis.
24699513 2014 A highly conserved Toxo1 haplotype directs resistance to toxoplasmosis and its associated caspase-1 dependent killing of parasite and host macrophage.
24439873 2014 NLRP1 inflammasome, and not NLRP3, is the key in the shift to proinflammatory state on endothelial cells in peripheral arterial disease.
24334646 2014 Deregulated NLRP3 and NLRP1 inflammasomes and their correlations with disease activity in systemic lupus erythematosus.
24065540 2013 MMP-2, TNF-? and NLRP1 polymorphisms in Chinese patients with ankylosing spondylitis and rheumatoid arthritis.
24008734 2013 Intravenous immunoglobulin suppresses NLRP1 and NLRP3 inflammasome-mediated neuronal death in ischemic stroke.
23940760 2013 TNF-? may mediate inflammasome activation in the absence of bacterial infection in more than one way.
23773036 2013 Association of NLRP1 genetic variants and mRNA overexpression with generalized vitiligo and disease activity in a Gujarat population.
23770116 2013 NLRP1 haplotypes associated with leprosy in Brazilian patients.
23563199 2013 Genetic variation in the inflammasome and atopic dermatitis susceptibility.
23508996 2013 Structure of the NLRP1 caspase recruitment domain suggests potential mechanisms for its association with procaspase-1.
23382179 2013 NLRP1 haplotypes associated with vitiligo and autoimmunity increase interleukin-1? processing via the NLRP1 inflammasome.
23380025 The role of the NLRP1 gene in systemic sclerosis: a replication study.
23374100 2013 Polymorphisms in NLRP1 gene and susceptibility to autoimmune thyroid disease.
23349227 2013 Whole exome sequencing identifies a mutation for a novel form of corneal intraepithelial dyskeratosis.
23253924 2013 Evidence of association of the NLRP1 gene with giant cell arteritis.
23053059 2013 Genetic variation in inflammasome genes is associated with outcome in bacterial meningitis.
22801494 2012 Novel role of PKR in inflammasome activation and HMGB1 release.
22665479 2012 Autolytic proteolysis within the function to find domain (FIIND) is required for NLRP1 inflammasome activity.
22524199 2012 Inflammasome polymorphisms confer susceptibility to sporadic malignant melanoma.
22507623 2012 Genetic susceptibility to Kawasaki disease: analysis of pattern recognition receptor genes.
22235789 2012 Polimorphisms in inflammasome genes are involved in the predisposition to systemic lupus erythematosus.
22227487 2012 Polymorphisms in inflammasome' genes and susceptibility to HIV-1 infection.
22117610 2012 NLRP1, a regulator of innate immunity associated with vitiligo.
22087307 2011 CARD8 and NLRP1 undergo autoproteolytic processing through a ZU5-like domain.
21976003 2012 NLRP1 gene polymorphism influences gene transcription and is a risk factor for rheumatoid arthritis in han chinese.
21946017 NALP1/NLRP1 genetic variants are associated with Alzheimer disease.
21376416 2011 No evidence for association of the polymorphisms in NLRP1 gene with type 1 diabetes in Poland.
21331694 2011 Evaluation of NLRP1 gene polymorphisms in Vogt-Koyanagi-Harada disease.
21252346 2011 Discovery of a viral NLR homolog that inhibits the inflammasome.
21245836 2011 The missense variation Q705K in CIAS1/NALP3/NLRP3 gene and an NLRP1 haplotype are associated with celiac disease.
21149496 2011 NLRP1 influences the systemic sclerosis phenotype: a new clue for the contribution of innate immunity in systemic sclerosis-related fibrosing alveolitis pathogenesis.
21098108 2011 NALP1 influences susceptibility to human congenital toxoplasmosis, proinflammatory cytokine response, and fate of Toxoplasma gondii-infected monocytic cells.
20800603 2010 Investigation of genetic susceptibility factors for human longevity - a targeted nonsynonymous SNP study.
20697295 2011 Genetic predictors of glucocorticoid response in pediatric patients with inflammatory bowel diseases.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20574744 2010 Genetic association of NALP1 with generalized vitiligo in Jordanian Arabs.
20502346 2010 A 3'UTR SNP in NLRP3 gene is associated with susceptibility to HIV-1 infection.
20403135 2010 The genetics of NOD-like receptors in Crohn's disease.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20370570 2010 Two SNPs in NLRP3 gene are involved in the predisposition to type-1 diabetes and celiac disease in a pediatric population from northeast Brazil.
20303873 2010 The inflammasomes.
20152874 2010 A coding variant in NLRP1 is associated with autoimmune Addison's disease.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19727120 2010 Fine-mapping of vitiligo susceptibility loci on chromosomes 7 and 9 and interactions with NLRP1 (NALP1).
19651869 2009 Expression of Nlrp1b inflammasome components in human fibroblasts confers susceptibility to anthrax lethal toxin.
19337385 2009 Evaluation of Nod-like receptor (NLR) effector domain interactions.
19223160 2009 Sensing pathogens and danger signals by the inflammasome.
19120479 2009 Inflammasomes: guardians of cytosolic sanctity.
19074885 2008 Genetic variants in apoptosis and immunoregulation-related genes are associated with risk of chronic lymphocytic leukemia.
19001869 2008 SNP-guided microRNA maps (MirMaps) of 16 common human disorders identify a clinically accessible therapy reversing transcriptional aberrations of nuclear import and inflammasome pathways.
18946481 2009 A coding polymorphism in NALP1 confers risk for autoimmune Addison's disease and type 1 diabetes.
18511561 2008 A NOD2-NALP1 complex mediates caspase-1-dependent IL-1beta secretion in response to Bacillus anthracis infection and muramyl dipeptide.
18348116 2008 A molecular dynamics study of the ASC and NALP1 pyrin domains at neutral and low pH.
18263805 2008 Inflammasome mRNA expression in human monocytes during early septic shock.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17637824 2007 Genetic variations in NALP1 are associated with generalized vitiligo in a Romanian population.
17620097 2007 Polymorphisms in NACHT-LRR (NLR) genes in atopic dermatitis.
17431422 2007 The SPRY domain of Pyrin, mutated in familial Mediterranean fever patients, interacts with inflammasome components and inhibits proIL-1beta processing.
17418785 2007 Bcl-2 and Bcl-XL regulate proinflammatory caspase-1 activation by interaction with NALP1.
17377159 2007 NALP1 in vitiligo-associated multiple autoimmune disease.
17349957 2007 Reconstituted NALP1 inflammasome reveals two-step mechanism of caspase-1 activation.
17164409 2007 Inflammasome components NALP 1 and 3 show distinct but separate expression profiles in human tissues suggesting a site-specific role in the inflammatory response.
16625196 2006 DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage.
16575408 2006 The estrogen-responsive B box protein: a novel enhancer of interleukin-1beta secretion.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15285719 2004 NALP1 is a transcriptional target for cAMP-response-element-binding protein (CREB) in myeloid leukaemia cells.
15212762 2004 Expression of NALP1 in cerebellar granule neurons stimulates apoptosis.
15107016 2004 Heterotypic interactions among NACHT domains: implications for regulation of innate immune responses.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14691733 2004 Novel vitiligo susceptibility loci on chromosomes 7 (AIS2) and 8 (AIS3), confirmation of SLEV1 on chromosome 17, and their roles in an autoimmune diathesis.
14527388 2003 NMR structure of the apoptosis- and inflammation-related NALP1 pyrin domain.
12563287 2003 NALPs: a novel protein family involved in inflammation.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12191486 2002 The inflammasome: a molecular platform triggering activation of inflammatory caspases and processing of proIL-beta.
11592035 2001 Evidence for a susceptibility gene, SLEV1, on chromosome 17p13 in families with vitiligo-related systemic lupus erythematosus.
11472070 2001 CLAN, a novel human CED-4-like gene.
11270363 2000 The PYRIN domain: a novel motif found in apoptosis and inflammation proteins.
11250163 2001 The pyrin domain: a possible member of the death domain-fold family implicated in apoptosis and inflammation.
11113115 2001 A novel enhancer of the Apaf1 apoptosome involved in cytochrome c-dependent caspase activation and apoptosis.
11076957 2001 Molecular cloning and characterization of DEFCAP-L and -S, two isoforms of a novel member of the mammalian Ced-4 family of apoptosis proteins.
10231032 1999 Prediction of the coding sequences of unidentified human genes. XIII. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro.
9110174 1997 Large-scale concatenation cDNA sequencing.
8781126 1996 Phylogeny and structure of the RING3 gene.
8619474 1996 A "double adaptor" method for improved shotgun library construction.