Property Summary

NCBI Gene PubMed Count 43
PubMed Score 87.81
PubTator Score 97.17

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
malignant mesothelioma -2.000 2.6e-05
group 3 medulloblastoma -1.700 1.0e-03
medulloblastoma, large-cell -3.200 5.4e-04
colon cancer -1.200 3.8e-05
interstitial cystitis -1.300 2.6e-02
pilocytic astrocytoma 1.300 1.6e-05
posterior fossa group A ependymoma -1.400 1.7e-03
Breast cancer -1.200 3.3e-02
lung carcinoma 3.100 2.4e-12
ductal carcinoma in situ -1.300 8.2e-04
invasive ductal carcinoma -1.700 1.3e-04
ovarian cancer -1.400 7.7e-07
pituitary cancer 1.800 1.7e-07

Protein-protein Interaction (1)

Gene RIF (25)

PMID Text
26674772 NLGN1 was associated with schizophrenia in Chinese Han Populations
26440732 Neuroligin 1 (NL1) promotes the formation of glutamatergic synapses and mediates long-term potentiation.
26109803 Neuroligin-1 and Glu may represent new markers of ganglion cells, whose expression may correlate with the pathogenesis, diagnosis, differential diagnosis or classification of Hirschsprung's disease.
26078884 Results indicate that the neurexin and neuroligin synaptic complex is intrinsically involved in the regulation of DISC1 function, thus contributing to a better understanding of the pathology of schizophrenia.
25428619 the expression of NL1 and its binding partner neurexin-1beta was increased in temporal lobe epileptic foci in patients and lithium-pilocarpine-treated epileptic rats.
25399301 Increasing expression of TGF-beta1 protein, decreasing expressions of Ghrelin, Neurexin, and Neuroligin proteins can induce the loss or dysfunction of ganglion cells in distal intestinal canal
23929743 We identified a cluster of single nucleotide polymorphisms at the NLGN1 locus showing significant association with BP variability. Follow-up analyses did not support an association with risk of ischemic stroke and its subtypes
23853109 Monitoring the attachment and detachment of neurexin (Nrx)-coated quantum dots measures the rates of neurexin (Nrx)/neuroligin interaction in the hippocampus.
23719805 these manipulations of NL1 function illuminate the significance of NL1 intracellular signaling in vivo, and enhance our understanding of the factors that gate the maturation of glutamatergic synapses and complex behavior
23264101 Expression levels of neurexin and neuroligin in ENS are significantly down-regulated in HSCR, which may be involved in the pathogenesis of HSCR.
21838267 Amyloid beta-peptide binds to the extracellular domain of neuroligin-1 with a K(d) in the nanomolar range.
20677014 Observational study of gene-disease association. (HuGE Navigator)
20516156 Observational study, meta-analysis, and genome-wide association study of gene-disease association. (HuGE Navigator)
20398908 Observational study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20201926 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
19736351 Observational study of gene-disease association. (HuGE Navigator)
19730411 Neuroligin-1 performs diverse synaptic functions by mechanisms that include as essential components of alpha-neurexin binding and neuroligin dimerization, but extend beyond these activities.
19598235 Observational study of gene-disease association. (HuGE Navigator)
19086053 Observational study of gene-disease association. (HuGE Navigator)
18987618 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
16882988 Our discoveries provide insight into the specific interaction of the GOPC PDZ domain with the C-terminal peptide of Nlg and also provide a general insight about the possible binding mode of the interaction of Nlg with other PDZ domain-containing proteins.
16077734 Neuroligin mutations most probably represent rare causes of autism; it is unlikely that the allelic variants in any of these genes would be major risk factors for autism.
15797875 the neurexin 1beta/neuroligin 1 complex has a role in synapse formation
14522992 glycosylation processing of neuroligin, in addition to mRNA splicing and gene selection, contributes to the specificity of the neurexin-beta/neuroligin-1 association

AA Sequence

MALPRCTWPNYVWRAVMACLVHRGLGAPLTLCMLGCLLQAGHVLSQKLDDVDPLVATNFGKIRGIKKELN      1 - 70
NEILGPVIQFLGVPYAAPPTGERRFQPPEPPSPWSDIRNATQFAPVCPQNIIDGRLPEVMLPVWFTNNLD     71 - 140
VVSSYVQDQSEDCLYLNIYVPTEDGPLTKKRDEATLNPPDTDIRDSGGPKPVMVYIHGGSYMEGTGNLYD    141 - 210
GSVLASYGNVIVITVNYRLGVLGFLSTGDQAAKGNYGLLDLIQALRWTSENIGFFGGDPLRITVFGSGAG    211 - 280
GSCVNLLTLSHYSEGNRWSNSTKGLFQRAIAQSGTALSSWAVSFQPAKYARMLATKVGCNVSDTVELVEC    281 - 350
LQKKPYKELVDQDIQPARYHIAFGPVIDGDVIPDDPQILMEQGEFLNYDIMLGVNQGEGLKFVENIVDSD    351 - 420
DGISASDFDFAVSNFVDNLYGYPEGKDVLRETIKFMYTDWADRHNPETRRKTLLALFTDHQWVAPAVATA    421 - 490
DLHSNFGSPTYFYAFYHHCQTDQVPAWADAAHGDEVPYVLGIPMIGPTELFPCNFSKNDVMLSAVVMTYW    491 - 560
TNFAKTGDPNQPVPQDTKFIHTKPNRFEEVAWTRYSQKDQLYLHIGLKPRVKEHYRANKVNLWLELVPHL    561 - 630
HNLNDISQYTSTTTKVPSTDITFRPTRKNSVPVTSAFPTAKQDDPKQQPSPFSVDQRDYSTELSVTIAVG    631 - 700
ASLLFLNILAFAALYYKKDKRRHDVHRRCSPQRTTTNDLTHAQEEEIMSLQMKHTDLDHECESIHPHEVV    701 - 770
LRTACPPDYTLAMRRSPDDVPLMTPNTITMIPNTIPGIQPLHTFNTFTGGQNNTLPHPHPHPHSHSTTRV    771 - 840
//

Text Mined References (45)

PMID Year Title
26674772 2015 Evidence for Association of Cell Adhesion Molecules Pathway and NLGN1 Polymorphisms with Schizophrenia in Chinese Han Population.
26440732 2015 A truncating mutation in Alzheimer's disease inactivates neuroligin-1 synaptic function.
26109803 2015 Abundance and significance of neuroligin-1 and glutamate in Hirschsprung's disease.
26078884 2015 Neurexin-Neuroligin Synaptic Complex Regulates Schizophrenia-Related DISC1/Kal-7/Rac1 "Signalosome".
25428619 2016 Neuroligin-1 Knockdown Suppresses Seizure Activity by Regulating Neuronal Hyperexcitability.
25399301 2015 TGF-?1, Ghrelin, Neurexin, and Neuroligin are predictive biomarkers for postoperative prognosis of laparoscopic surgery in children with Hirschsprung disease.
24613359 2014 Calsyntenins function as synaptogenic adhesion molecules in concert with neurexins.
24024966 2013 Genome-wide association study of chronic periodontitis in a general German population.
23929743 2013 Genome-wide analysis of blood pressure variability and ischemic stroke.
23853109 2013 Assembly of synapses: biomimetic assays to control neurexin/neuroligin interactions at the neuronal surface.
23719805 2013 Neuroligin1 drives synaptic and behavioral maturation through intracellular interactions.
23264101 2013 Expression of neurexin and neuroligin in the enteric nervous system and their down-regulated expression levels in Hirschsprung disease.
23143522 2012 Neuroligin-1-dependent competition regulates cortical synaptogenesis and synapse number.
22750515 2012 Neuroligin-1 induces neurite outgrowth through interaction with neurexin-1? and activation of fibroblast growth factor receptor-1.
21838267 2011 The synaptic protein neuroligin-1 interacts with the amyloid ?-peptide. Is there a role in Alzheimer's disease?
20677014 2010 An approach based on a genome-wide association study reveals candidate loci for narcolepsy.
20516156 2010 Genome-wide association study of major recurrent depression in the U.K. population.
20398908 2010 Comprehensive copy number variant (CNV) analysis of neuronal pathways genes in psychiatric disorders identifies rare variants within patients.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20201926 2010 Human variation in alcohol response is influenced by variation in neuronal signaling genes.
20034102 2010 Characterization of the neuroligin gene family expression and evolution in zebrafish.
19926856 2009 The synaptic proteins neurexins and neuroligins are widely expressed in the vascular system and contribute to its functions.
19736351 2009 Recurrent rearrangements in synaptic and neurodevelopmental genes and shared biologic pathways in schizophrenia, autism, and mental retardation.
19730411 2009 Neuroligin-1 performs neurexin-dependent and neurexin-independent functions in synapse validation.
19598235 2009 Genes related to sex steroids, neural growth, and social-emotional behavior are associated with autistic traits, empathy, and Asperger syndrome.
19086053 2009 Identification of new putative susceptibility genes for several psychiatric disorders by association analysis of regulatory and non-synonymous SNPs of 306 genes involved in neurotransmission and neurodevelopment.
18987618 2009 Screening for replication of genome-wide SNP associations in sporadic ALS.
18755801 2008 Expression of neurexin, neuroligin, and their cytoplasmic binding partners in the pancreatic beta-cells and the involvement of neuroligin in insulin secretion.
17474715 2007 A thermodynamic ligand binding study of the third PDZ domain (PDZ3) from the mammalian neuronal protein PSD-95.
16882988 2006 Solution structure of GOPC PDZ domain and its interaction with the C-terminal motif of neuroligin.
16641997 2006 The DNA sequence, annotation and analysis of human chromosome 3.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16077734 2005 Analysis of four neuroligin genes as candidates for autism.
15797875 2005 Dissection of synapse induction by neuroligins: effect of a neuroligin mutation associated with autism.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14522992 2003 Characterization of the interaction of a recombinant soluble neuroligin-1 with neurexin-1beta.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10996085 2000 Synapse formation: if it looks like a duck and quacks like a duck ....
10892652 2000 Neuroligin expressed in nonneuronal cells triggers presynaptic development in contacting axons.
10819331 2000 Prediction of the coding sequences of unidentified human genes. XVII. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro.
10470851 1999 Prediction of the coding sequences of unidentified human genes. XIV. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro.
9278515 1997 Binding of neuroligins to PSD-95.
8576240 1996 Structures, alternative splicing, and neurexin binding of multiple neuroligins.
7736595 1995 Neuroligin 1: a splice site-specific ligand for beta-neurexins.