Property Summary

NCBI Gene PubMed Count 92
PubMed Score 140.47
PubTator Score 199.89

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count Z-score Confidence
Prostatic Neoplasms 495 0.0 0.0
Disease Target Count Z-score Confidence
Prostate cancer 175 5.911 3.0
Disease Target Count Z-score Confidence
Cancer 2499 0.0 4.0
Disease Target Count Z-score Confidence
Carcinoma 11493 3.604 1.8

Expression

  Differential Expression (10)

Disease log2 FC p
cystic fibrosis 1.071 3.8e-04
ductal carcinoma in situ 1.700 4.8e-02
group 3 medulloblastoma -1.100 1.2e-02
intraductal papillary-mucinous neoplasm ... 1.600 2.5e-03
invasive ductal carcinoma -1.208 1.9e-02
lung cancer -1.800 2.7e-03
malignant mesothelioma -3.400 2.8e-08
osteosarcoma 1.544 6.2e-08
ovarian cancer -4.000 2.4e-20
pituitary cancer -1.100 5.0e-05

 GO Component (2)

Gene RIF (76)

AA Sequence

MLRVPEPRPGEAKAEGAAPPTPSKPLTSFLIQDILRDGAQRQGGRTSSQRQRDPEPEPEPEPEGGRSRAG      1 - 70
AQNDQLSTGPRAAPEEAETLAETEPERHLGSYLLDSENTSGALPRLPQTPKQPQKRSRAAFSHTQVIELE     71 - 140
RKFSHQKYLSAPERAHLAKNLKLTETQVKIWFQNRRYKTKRKQLSSELGDLEKHSSLPALKEEAFSRASL    141 - 210
VSVYNSYPYYPYLYCVGSWSPAFW                                                  211 - 234
//

Text Mined References (93)

PMID Year Title