Property Summary

NCBI Gene PubMed Count 15
PubMed Score 11.93
PubTator Score 9.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
psoriasis 6685 2.2e-16
Disease Target Count Z-score Confidence
Tethered spinal cord syndrome 12 4.227 2.1

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis 2.400 2.2e-16

Gene RIF (5)

PMID Text
23604637 Results show that Nkx2-8 functions as a tumor suppressor in esophageal squamous cell carcinoma (ESCC), the downregulation of which contributes to NF-kappaB P65 activation and ESCC angiogenesis.
22223847 overexpression of Nkx2.8 resulted in downregulation of p-FOXO3a and inhibition of MEK/ERK pathway activity. silencing Nkx2.8 led to upregulation of p-FOXO3a and increase of MEK/ERK pathway activity.
21148747 Most tumors have low expression of Nkx2-8, and its expression can inhibit growth of some lung cancer cells.
19279207 Coactivation of the TTF-1 and NKX2-8 pathways identified a cluster of lung cancer patients with poor survival and were shown to exhibit resistance to cisplatin
12167706 A murine Nkx2.8 was isolated from the Hepal-6 cell line and showed oligonucleotide binding competitive with fetoprotein transcription factor.

AA Sequence

MATSGRLSFTVRSLLDLPEQDAQHLPRREPEPRAPQPDPCAAWLDSERGHYPSSDESSLETSPPDSSQRP      1 - 70
SARPASPGSDAEKRKKRRVLFSKAQTLELERRFRQQRYLSAPEREQLASLLRLTPTQVKIWFQNHRYKLK     71 - 140
RARAPGAAESPDLAASAELHAAPGLLRRVVVPVLVRDGQPCGGGGGGEVGTAAAQEKCGAPPAAACPLPG    141 - 210
YPAFGPGSALGLFPAYQHLASPALVSWNW                                             211 - 239
//

Text Mined References (17)

PMID Year Title
24087792 2014 Dynamic changes in DNA methylation and hydroxymethylation when hES cells undergo differentiation toward a neuronal lineage.
23874236 2013 Genome-wide association mapping in dogs enables identification of the homeobox gene, NKX2-8, as a genetic component of neural tube defects in humans.
23674368 2013 Methylation-specific digital karyotyping of HPV16E6E7-expressing human keratinocytes identifies novel methylation events in cervical carcinogenesis.
23604637 2013 Nkx2-8 downregulation promotes angiogenesis and activates NF-?B in esophageal cancer.
22223847 2012 The tumor-suppressor gene Nkx2.8 suppresses bladder cancer proliferation through upregulation of FOXO3a and inhibition of the MEK/ERK signaling pathway.
21163872 2011 One allele's loss is another's gain: alterations of NKX2-8 in non-small cell lung cancer.
21148747 2011 Both gene amplification and allelic loss occur at 14q13.3 in lung cancer.
19279207 2009 Characterizing the developmental pathways TTF-1, NKX2-8, and PAX9 in lung cancer.
17925434 2007 Oncogenic cooperation and coamplification of developmental transcription factor genes in lung cancer.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15467763 2004 Identification of 27 5' CpG islands aberrantly methylated and 13 genes silenced in human pancreatic cancers.
15235609 2004 SMYD3 encodes a histone methyltransferase involved in the proliferation of cancer cells.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12167706 2002 Regulation of alpha-fetoprotein expression by Nkx2.8.
11252173 2001 Comparative analysis of the genomic organization of Pax9 and its conserved physical association with Nkx2-9 in the human, mouse, and pufferfish genomes.
9446603 1998 A novel nk-2-related transcription factor associated with human fetal liver and hepatocellular carcinoma.