Property Summary

NCBI Gene PubMed Count 4
PubMed Score 2.02
PubTator Score 0.36

Knowledge Summary

Patent

No data available

AA Sequence

MSLSPKHTTPFSVSDILSPIEETYKKFSGAMDGAPPGLGAPLGAAAAYRAPPPGPSSQAATVAGMQPSHA      1 - 70
MAGHNAAAAAAAAAAAAAAAATYHMPPGVSQFPHGAMGSYCNGGLGNMGELPAYTDGMRGGAATGWYGAN     71 - 140
PDPRYSSISRFMGPSAGVNVAGMGSLTGIADAAKSLGPLHAAAAAAAPRRKRRVLFSQAQVYELERRFKQ    141 - 210
QKYLSAPEREHLASMIHLTPTQVKIWFQNHRYKMKRQAKDKAAQQLQQEGGLGPPPPPPPSPRRVAVPVL    211 - 280
VKDGKPCQNGASTPTPGQAGPQPPAPTPAPELEELSPSPPALHGPGGGLAALDAAAGEYSGGVLGANLLY    281 - 350
GRTW                                                                      351 - 354
//

Text Mined References (4)

PMID Year Title