Property Summary

NCBI Gene PubMed Count 38
PubMed Score 30.60
PubTator Score 17.42

Knowledge Summary

Patent

No data available

Expression

Gene RIF (26)

PMID Text
24473197 The persons with a NKX2-3 G or T allele may have a moderately increased risk of CD.
22377701 A positive correlation was observed between mRNA expression of PTPN2 and NKX2-3 in B cells and in intestinal tissues from both Crohn's disease and ulcerative colitis patients.
21968973 NKX2-3 may play different roles in ulcerative colitis and Crohn's disease pathogenesis by differential regulation of EGR1.
21803625 The binding of NFAT1 to the NKX2-3 promoter region with rs1190140 was confirmed by chromatin immunoprecipitation assay.
21637825 NKX2-3 may play an important role in inflammatory bowel disease pathogenesis by regulating endothelin-1 and VEGF signaling in human intestinal microvascular endothelial cells.
21514341 the risk haplotype of NKX2.3 confers susceptibility to UC through increasing expression of NKX2.3 mRNA in the colonic mucosa.
21072187 Observational study of gene-disease association. (HuGE Navigator)
21049557 Data suggest that NKX2-3 and IRGM are susceptibility loci for inflammatory bowel disease in Eastern European patients.
21049557 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20886065 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20473688 Observational study of gene-disease association. (HuGE Navigator)
20188614 a decrease in Nkx2-3 gene expression level can profoundly alter the expression of genes and cellular functions relevant to the pathogenesis and progression of inflammatory bowel disease, such as EDN1.
20165982 Nkx2-3 may contribute to the pathogenesis of inflammatory bowel disease-associated colorectal cancer and sporadic colorectal cancer by regulating the Wnt signaling pathway.
19861958 Observational study of gene-disease association. (HuGE Navigator)
19760754 Observational study of gene-disease association. (HuGE Navigator)
19683022 no evidence of association with celiac disease has been reported for the Crohn's disease susceptibility polymorphisms studied in the NKX2-3, ATG16L1, and IRGM genes.
19683022 Observational study of gene-disease association. (HuGE Navigator)
19422935 Observational study of gene-disease association. (HuGE Navigator)
19174780 Observational study of gene-disease association. (HuGE Navigator)
18936107 A positive association signal presumably common to different ethnic groups for rs10883365 was detected in the upstream region of NKX2-3.
18936107 Observational study of gene-disease association. (HuGE Navigator)
18438406 Observational study of gene-disease association. (HuGE Navigator)
18438405 Single nucleotide polymorphism in NKX2-3 gene is associated with Crohn's disease and ulcerative colitis
18438405 Observational study of gene-disease association. (HuGE Navigator)
17554261 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
16385451 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MMLPSPVTSTPFSVKDILNLEQQHQHFHGAHLQADLEHHFHSAPCMLAAAEGTQFSDGGEEDEEDEGEKL      1 - 70
SYLNSLAAADGHGDSGLCPQGYVHTVLRDSCSEPKEHEEEPEVVRDRSQKSCQLKKSLETAGDCKAAEES     71 - 140
ERPKPRSRRKPRVLFSQAQVFELERRFKQQRYLSAPEREHLASSLKLTSTQVKIWFQNRRYKCKRQRQDK    141 - 210
SLELGAHAPPPPPRRVAVPVLVRDGKPCVTPSAQAYGAPYSVGASAYSYNSFPAYGYGNSAAAAAAAAAA    211 - 280
AAAAAAYSSSYGCAYPAGGGGGGGGTSAATTAMQPACSAAGGGPFVNVSNLGGFGSGGSAQPLHQGTAAG    281 - 350
AACAQGTLQGIRAW                                                            351 - 364
//

Text Mined References (39)

PMID Year Title
24737748 2014 Identification of susceptibility loci for colorectal cancer in a genome-wide meta-analysis.
24473197 2014 Contribution of NKX2-3 polymorphisms to inflammatory bowel diseases: a meta-analysis of 35358 subjects.
23222517 2012 Seventy-five genetic loci influencing the human red blood cell.
23128233 2012 Host-microbe interactions have shaped the genetic architecture of inflammatory bowel disease.
23064961 2013 GWAS of dental caries patterns in the permanent dentition.
22412388 2012 A genome-wide scan of Ashkenazi Jewish Crohn's disease suggests novel susceptibility loci.
22377701 2012 PTPN2 is associated with Crohn's disease and its expression is regulated by NKX2-3.
21968973 2012 Genes differentially regulated by NKX2-3 in B cells between ulcerative colitis and Crohn's disease patients and possible involvement of EGR1.
21803625 NKX2-3 variant rs11190140 is associated with IBD and alters binding of NFAT.
21637825 2011 NKX2-3 transcriptional regulation of endothelin-1 and VEGF signaling in human intestinal microvascular endothelial cells.
21514341 2011 Increased expression of NKX2.3 mRNA transcribed from the risk haplotype for ulcerative colitis in the involved colonic mucosa.
21102463 2010 Genome-wide meta-analysis increases to 71 the number of confirmed Crohn's disease susceptibility loci.
21072187 2010 Evidence for significant overlap between common risk variants for Crohn's disease and ankylosing spondylitis.
21049557 2010 NKX2-3 and IRGM variants are associated with disease susceptibility to IBD in Eastern European patients.
20886065 2010 Molecular reclassification of Crohn's disease by cluster analysis of genetic variants.
20473688 2010 Association between genome-wide association studies reported SNPs and pediatric-onset Crohn's disease in Canadian children.
20228799 2010 Genome-wide association identifies multiple ulcerative colitis susceptibility loci.
20228798 2010 Genome-wide association study for ulcerative colitis identifies risk loci at 7q22 and 22q13 (IL17REL).
20188614 2010 Genes regulated by Nkx2-3 in siRNA-mediated knockdown B cells: implication of endothelin-1 in inflammatory bowel disease.
20165982 2010 Genes regulated by Nkx2-3 in sporadic and inflammatory bowel disease-associated colorectal cancer cell lines.
19861958 2010 Genetic analysis in a Dutch study sample identifies more ulcerative colitis susceptibility loci and shows their additive role in disease risk.
19760754 2010 Analysis of 39 Crohn's disease risk loci in Swedish inflammatory bowel disease patients.
19683022 2009 Lack of association of NKX2-3, IRGM, and ATG16L1 inflammatory bowel disease susceptibility variants with celiac disease.
19422935 2009 Genetic risk profiling and prediction of disease course in Crohn's disease patients.
19174780 2009 Confirmation of multiple Crohn's disease susceptibility loci in a large Dutch-Belgian cohort.
18936107 2009 Positive association of genetic variants in the upstream region of NKX2-3 with Crohn's disease in Japanese patients.
18587394 2008 Genome-wide association defines more than 30 distinct susceptibility loci for Crohn's disease.
18438406 2008 Genetic determinants of ulcerative colitis include the ECM1 locus and five loci implicated in Crohn's disease.
18438405 2008 Replication of signals from recent studies of Crohn's disease identifies previously unknown disease loci for ulcerative colitis.
17554300 2007 Genome-wide association study of 14,000 cases of seven common diseases and 3,000 shared controls.
17554261 2007 Sequence variants in the autophagy gene IRGM and multiple other replicating loci contribute to Crohn's disease susceptibility.
16385451 2006 A scan of chromosome 10 identifies a novel locus showing strong association with late-onset Alzheimer disease.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15164054 2004 The DNA sequence and comparative analysis of human chromosome 10.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12141427 2002 NK-2 class homeobox genes and pharyngeal/oral patterning: Nkx2-3 is required for salivary gland and tooth morphogenesis.
11457859 2001 Differential binding of an SRF/NK-2/MEF2 transcription factor complex in normal versus neoplastic smooth muscle tissues.
8812123 1996 NK-2 homeobox genes and heart development.