Property Summary

NCBI Gene PubMed Count 233
PubMed Score 1210.58
PubTator Score 625.03

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
malignant mesothelioma 6.500 4.7e-09
non-small cell lung cancer -2.534 2.0e-11
lung cancer -7.900 2.4e-08

Gene RIF (203)

PMID Text
26556242 EGFR knockdown led to upregulation of NKX2-1, suggesting a negative feedback loop. combined knockdown of NKX2-1 and EGFR in NCI-H1819 lung cancer cells reduced cell proliferation more than knockdown of either alone.
26456962 Suggest TTF-1 is a reliable marker in non-small cell lung carcinoma and can be used in differential diagnosis.
26356687 Mutations of TTF1 is associated with risk of Papillary Thyroid Cancer in Chinese. Patients with Multiplendular goiter and no metastasis are more likely to suffer PTC. C/T variant of TTF1 had a high correlation with PTC in the overall population.
26337230 Preoperative serum miR-365 and TTF-1 mRNA levels may be effective indicators of tumor aggressiveness in human NSCLC. miR-365 and its target gene TTF-1 appear to be synergistic risk factors for the reduction in overall survival of patients with NSCLC.
26316052 In adenocarcinomas from extrahepatic biliary tract, there was no correlation between TTF-1 expression and the clinicopathological characteristics.
26247534 Letter/Case Report: Merkel cell carcinoma with diffuse TTF-1 expression.
26206751 genetic susceptibility to thyroid cancer seems likely to be associated with the risk allele at rs944289
26045746 Aberrant expression of mir-365/TTF-1 may be involved in the tumor development in patients with non-small cell lung carcinoma.
25944390 Different staining patterns can be seen with CK5/6 and p63; however, if they are used together with TTF-1 they can be used in subtyping lung neoplasms.
25934249 Case Report: uprasellar chordoid glioma expression thyroid transcription factor 1.
25918229 Letter/Case Report: TTF1 positive breast neoplasm.
25893822 TTF-1 is considered to be an excellent marker of pituicytes, specialized glia of the neurohypophysis.
25889870 TTF-1 had no prognostic value concerning OS, but may serve as a predictor for response to first line chemotherapy in small cell lung cancer.
25881545 Authors suggest that NKX2-1 as a tumour suppressor or a tumour promoter in lung adenocarcinoma progression is dependent on p53 status.
25854394 TTF1 expression was not a prognostic marker in advanced non-squamous NSCLC.
25733373 the combination of MUC5B and TTF-1 expression is useful for discriminating adenocarcinomas from squamous cell carcinomas, yielding prognostic significance in patients with lung adenocarcinoma.
25426816 NKX2-1 genetic mutation have been shown to cause cardiac conduction disorders.
25425970 Data suggest that induction of foxhead box M1(FOXM1) by E6 oncoprotein through the transcription factors MZF1/NKX2-1 axis may be responsible for human papillomavirus 16/18-mediated tumor progression.
25337222 CK5/6, IMP3 and TTF1 immunostaining appears to be useful to improve the accuracy of cytological diagnoses between reactive mesothelial cells, metastatic adenocarcinoma of lung and non-lung origin in pleural effusion.
25247229 Neither a gastric adenocrcinoma with diffuse TTF-1 expression nor a TTF-1-positive gallbladder adenocarcinoma has been described before.
25063315 There were differences between CK5/6, p63,CK34betaE12 and TTF-1 expression with tumor differentiation in squamous cell carcinoma or adenocarcinomas
25060702 TTF-1 colocalizes with Smad3 on chromatin and alters Smad3-binding patterns throughout the genome, while TTF-1 generally inhibits Smad4 binding to chromatin.
24930029 study identified a new nonsense mutation associated with ataxia, benign chorea and pituitary abnormalities in a UK family
24913303 TTF-1 nuclear expression in high-grade astrocytic tumors cannot rule out primaries even when diffuse and strong staining
24901475 Case Report: Merkel cell carcinma that initially TTF-1 negative but gained expression in subsequent brain metastases.
24778062 Primary non-small cell lung cancer tumors expressing TTF1 had lower fluorodeoxyglucose uptake than those that did not and this was a good prognostic indicator.
24743427 In lung adenocarcinomas, positive and partial positive TTF-1 expression has a significant positive correlation with EGFR mutations(exon 19 and 21).
24689794 Evaluation of the microvessel density and the expression of MMP2 and MMP9 and TTF1 in the different subtypes of lung adenocarcinoma in Tunisia
24594201 Overexpression of TTF1 was associated with lung cancer.
24457236 Loss of TTF-1 is associated with low response to chemotherapy in non-small-cell lung cancer.
24453141 study described 3 individuals from 2 generations of a nonconsanguineous family with hypothyroidism and chorea explained by a novel mutation in the NKX2-1 gene; despite having no pulmonary findings, their condition can be classified as brain-thyroid-lung syndrome
24452548 SNP rs944289 associated with increased risk of papillary thyroid carcinoma in Han population of Northern China
24418856 Report thyroid transcription factor-1/napsin-A coexpression in a subset of cholangiocarcinomas arising from the gallbladder and hepatic ducts.
24370340 Report significant genotype-phenotype correlations between EGFR mutations and adenocarcinoma histologic subtypes and TITF-1/SP-A expression.
24331839 TTF-1 is more sensitive than napsin for detection of lung sarcomatoid carcinoma, and no cases were positive for napsin but negative for TTF-1
24267480 Our study confirms that TTF-1 is expressed in a small, but not insignificant, proportion of endometrial adenocarcinomas. TTF-1 positivity in low-grade endometrioid adenocarcinomas is an indicator of poorer prognosis.
24207093 TTF-1 achieved moderate sensitivity, and high specificity in the diagnosis of AC, while P63 was highly sensitive and specific for the diagnosis of SCC.
24171694 This study demonistrated that nine novel mutation of NKX2.1 in patient with Benign hereditary chorea.
24129101 Although rare, the triad of congenital hypothyroidism, neurological, and respiratory signs is highly suggestive of NKX2-1 anomalies
24111789 Both TTF-1 antibodies (clones 8G7G3/1 and SPT24) were useful in differentiating breast from pulmonary carcinomas. Nuclear expression of TTF-1 was detected in invasive breast cancers by 8G7G3/1, but not by SPT24.
24051510 No TTF1 or EAP1 germline mutations were associated with central pubertal disorders. TTF1 and EAP1 may affect puberty by changing expression in response to other members of puberty-associated gene networks
24014739 overexpression of TTF1 confers tumorigenicity to thyrocytes.
23995788 losses of LKB1 at the transcriptional level by altered activity of the NKX2-1/p53 pathway may promote tumor malignancy and poor patient outcome.
23988776 in lung adenocarcinomas, KRAS mutations are prevalent in male smokers; EGFR mutations are associated with female sex, nonsmoking and lepidic and micropapillary growth; TTF1 has a role in survival; BRAF mutations have roles in survival
23958551 The expression of GATA3 and TTF1 distinguishes metastatic mammary carcinoma from primary lung carcinoma.
23911641 7bp deletion in NKX2.1 was identified in a father and his 2 children diagnosed with ataxic cerebral palsy.
23899066 24 cases each of pulmonary and esophageal adenocarcinoma were stained with TTF-1, napsin A, CDX2, 34betaE12, N-cadherin, and IMP3 in an attempt to find an optimal panel for differentiation. IMP3, CDX2, and N-cadherin are superior to either TTF-1 or napsin A.
23818522 The complexity of thyroid transcription factor 1 with both pro- and anti-oncogenic activities.
23787483 genetic mechanisms may cause neuroendocrine cell hyperplasia of infancy and that NKX2.1 mutations may result in, but are not the predominant cause of, this phenotype
23787483 altered expression of NKX2.1 target genes other than those in the surfactant system may be responsible for the pulmonary pathophysiology of neuroendocrine cell hyperplasia of infancy
23787439 The differential expression of PAX8 and TTF-1 may prove useful in distinguishing between neuroendocrine carcinomas of pulmonary and thymic origin
23763999 A review of recent findings with special attention given to the role of NKX2-1 in lung development and carcinogenesis.
23675755 Our population-based findings indicate that TTF-1 may be positive in approximately 3% of primary breast cancers, and positivity indicates an association with adverse prognostic factors.
23658034 A TITF1 mutation(c.825delC) was detected in 2 sisters with chorea.
23637834 ectopic expression of NKX2-1 in diffuse large B-cell lymphoma cells
23625920 MicroRNA-33a mediates the regulation of high mobility group AT-hook 2 gene (HMGA2) by thyroid transcription factor 1 (TTF-1/NKX2-1).
23525704 TTF1 gene amplification is associated with response to therapy in lung adenocarcinomas.
23514941 TTF-1 may serve as a tumor suppressor gene based on its inverse correlation with Ki-67 proliferative activity
23507558 data suggests that miR-365 suppresses the expression and therefore the oncogenic functions of NKX2-1 in lung cancer
23418554 Data suggest that multi-antibody assay of TTF1, Vimentin, p63 CD56, chromogranin and synaptophysin may be of special value, especially in diagnosing small biopsies.
23379327 Data suggest that a frameshift mutation in NKX2-1 (deletion of a cytosine at position 834) is responsible for brain-thyroid-lung syndrome in 5 members of a Brazilian family. [CASE REPORT]
23361500 Novel mutation of NKX2.1 protein associated with hypothyroidism and lethal respiratory failure in a full term newborn.
23358112 TTF1 expression in small-cell lung cancer is a cell lineage-specific phenomenon that involves the developing neural cell-specific homeoprotein BRN2.
23330966 TTF-1 expression in a case of CK7/CK20-positive Merkel cell carcinoma.
23322301 suggest that LMO3 is a transcriptional signal transducer in NKX2-1-amplified lung adenocarcinomas
23259454 Binding of Activin-A-responsive SMAD2 to the NKX2-1 promoter plays essential role during respiratory endoderm specification.
23169673 Deletions at 14q13.3 adjacent to but not involving NKX2-1.
23125078 summarizes the role of this transcription factor in the development, diagnosis, and prognosis of lung cancer in the hope of providing insights into the utility of Nkx2-1 as a novel biomarker of lung cancer.
22982653 Positive NKX2-1 is associated with EGFR mutation in non-small-cell lung cancer.
22959176 In this family with benign hereditary chorea we found a C to T transition that produced a non-sense mutation
22940844 TTF-1 may serve as a tumor suppressor gene based on its inverse correlation with Ki-67 proliferative activity and increase of cellular apoptosis
22832740 The TITF1/NKX2-1 gene is essential for organogenesis of the basal ganglia, thyroid and lungs. In this study, all patients had private mutations, including 7 new ones, 3 previously reported mutations & 3 sporadic deletions in the NKX2-1 gene.
22825795 This study demonistrated that Benign hereditary chorea: dopaminergic brain imaging in patients with a novel intronic NKX2.1 gene mutation.
22761434 TTF-1 transcriptionally regulates occludin, which represents another avenue of TTF-1-mediated metastasis suppression
22531686 because strong TTF-1 positivity was observed in the hyperplastic type II pneumocytes that were sometimes seen entrapped within the tumor, it is concluded that the presence of these entrapped cells was one of the most likely causes of the discrepancies
22495359 All 16 metastatic PETs were positively stained for IMP3 with 12 cases (75%) showing a diffuse and moderate-to-strong staining pattern while they were negative for TTF-1
22460811 TTF-1 expression in normal endometrium is associated with a reduced risk of endo-metrial cancer development.
22439932 NKX2-1 induces the expression of the receptor tyrosine kinase-like orphan receptor 1 (ROR1), which in turn sustains a favorable balance between prosurvival PI3K-AKT and pro-apoptotic p38 signaling.
22383183 Assessed gene amplifications and protein expression of NKX2-1 and FOXA1 in primary lung tumors (n = 554) and brain metastases (n = 68).
22242187 Expression levels of Nkx2-1 direct target genes identified in mouse development significantly correlate or anti-correlate to the levels of endogenous NKX2-1 in a dosage-dependent manner in multiple human lung tumor expression data sets.
22237264 High TTF-1 expression is associated with smoking and lung adenocarcinoma histology
22185756 signaling loop between transforming growth factor beta (TGFb) and miR-365 and this loop reinforced suppression of TTF-1 via miR-365
22166853 NKX2-1 haploinsufficiency causes dysfunction of the basal ganglia, especially the caudate nuclei, resulting in choreoathetosis and gait disturbance in patietns with brain-lung-thyroid syndrome.
22085929 MYBPH is a transcriptional target of TTF-1, which may elucidate the molecular mechanism whereby TTF-1 paradoxically inhibits cancer invasion & metastasis.
22011671 Patients with lung adenocarcinoma without thyroid transcription factor 1 (TTF1) amplification tend to have better prognoses than those with TTF1 amplification in cases with positive TTF1 expressions.
21982616 Although choreic movement caused by a novel TITF-1 nonsense mutation in benign hereditary chorea/Brain-Thyroid-Lung syndrome is recognized as non-progressive, this proband shows re-exacerbation of choreic movement at puberty.
21838611 Diagnostic utility of PAX8, TTF-1 and napsin A for discriminating metastatic carcinoma from primary adenocarcinoma of the lung.
21836499 Follicular dendritic cell sarcoma of the head and neck expressing thyroid transcription factor-1
21836486 Letter: TTF-1 was not found in embryonal tumors using immunohistochemistry.
21813802 This study suggested that novel mutation of thyroid transcription factor 1 is releated to Brain-lung-thyroid disease.
21784970 TNF-alpha inhibits TTF-1 gene transcription and promoter activity, indicating that transcriptional mechanisms play important roles in the inhibition of TTF-1 levels.
21775107 Merkel cell carcinoma admixed with squamous cell carcinoma can be cytokeratin 20-negative and thyroid transcription factor-1-positive [case report]
21771032 Thyroid transcription factor-1 expression in four cases of mammary ductal carcinoma.
21730105 Both FOXE1 and NKX2-1 were associated with the increased risk of sporadic Japanese PTC.
21717589 Data suggest that the panels of Napsin A, TTF-1, and p63 were effective in identifying histologic type in NSCLC, and that a combination of either Napsin A and p63 or TTF-1 and p63 should be chosen, depending on morphology.
21716147 High TTF1 expression is associated with treatment response in non-small cell lung cancer.
21677782 Data show that human HOXB5 binds to the promoter region 5' upstream of the binding site of NKX2-1 and regulates RET expression.
21562130 NKX2-1 was suppressed in airway epithelial cells from patients with asthma.
21555194 describe the clinical phenotype and response to levodopa treatment in a 6 year-old girl affected with sporadic non-progressive chorea, and a de novo TITF-1 gene mutation
21481790 NKX2-1, NKX2-2, and MEF2C define oncogenic pathways in T cell acute lymphoblastic leukemia (T-ALL).
21471965 link Nkx2-1 downregulation to loss of differentiation, enhanced tumour seeding ability and increased metastatic proclivity
21464700 in combination with napsin A-positive immunostaining helps in differentiating primary lung adenocarcinoma
21425409 Diversity of cell types that can be generated from human NKX2.1(+) progenitors and this demonstrates the utility of NKX2.1(GFP/w) hESCs for investigating human forebrain development and neuronal differentiation.
21343336 TTF-1 synchronously upregulates both HLA class I antigen and thyroid-specific autoantigen, which may be involved in the pathological process of Hashimoto autoimmune thyroiditis.
21257719 Data show distinct significant correlations between TITF-1 protein expression and DNA copy gain with mutations in the lung adenocarcinoma-prevalent EGFR and KRAS oncogenes.
21203907 Low TTF1 expression is associated with small cell carcinomas of the bladder.
21164283 Immunohistochemical staining using a combination of TTF-1, napsin A, p63, and CK5/6 allows subclassification of poorly differentiated non-small cell carcinomas on small lung biopsies in most cases.
21036415 co-expression with p63 in lung signet-ring cell carcinoma
20848248 TTF-1 is useful in separating adenocarcinoma of the lung from non-pulmonary adenocarcinoma and malignant mesothelioma
20830690 Although TTF-1 had a higher sensitivity, napsin-A was useful as a surrogate marker when encountering a poorly differentiated lung adenocarcinoma.
20823767 The clinicopathologic features of the first case of a thymoma with a strong nuclear expression of thyroid transcription factor-1 are reported.
20734064 Observational study of gene-disease association. (HuGE Navigator)
20701785 Observational study of gene-disease association. (HuGE Navigator)
20565809 Case Report: Describe an infiltrating breast tumour with thyroid transcription factor-1 (TTF-1) positive staining and ductal differentiation.
20518411 TTF-1 and CDX-2 are specific markers to separate metastatic pulmonary and GI ACs, respectively, from other metastatic ACs in serous effusions.
20471712 TTF-1 mRNA-expressing CTCs might be a useful surrogate predictor of disease progression for non-small cell lung cancer (NSCLC) patients before clinical manifestations are apparent.
20302910 genetics and phenomics of hypothyroidism and thyroid dysgenesis due to TTF1 mutations (Review)
20182342 TTF1 positivity is extremely common and may be a useful marker of a neuroendocrine carcinoma.
20157192 Observational study of gene-disease association. (HuGE Navigator)
20042854 thyroid transcription factor-1 in colorectal carcinoma
20020530 gain and loss of function of mutated NKX2-1 genes on surfactant protein promoters were associated with interstitial lung disease in "Brain-Lung-Thyroid syndrome&quot.
19906647 DNA methylation and chromatin modifications cooperate with Nkx2-1 to regulate Sftpb gene cell specific expression.
19740516 The combined use of napsin A and thyroid transcription factor-1 results in improved sensitivity and specificity for identifying pulmonary adenocarcinoma in primary lung tumors and in a metastatic setting.
19730683 Observational study of gene-disease association. (HuGE Navigator)
19578049 A rare case of TTF-1 positive small cell carcinoma of the breast with an in situ component is presented.
19525896 TTF-1 is strongly expressed in fetal and adult human pituicytes
19506552 No methylation in the CpG of TTF-1 promoter was detected in normal thyroids or papillary carcinomas. In contrast, DNA methylation was identified in 60% of the undifferentiated carcinomas.
19483637 TTF-1 might have a functional and developmental role in normal fallopian tube and endometrium
19464057 Observational study of gene-disease association. (HuGE Navigator)
19430419 the percentage of lung carcinoma patients remaining unclassifiable by TTF-1/TP63 was twice that of the five-antibody (TRIM29, CEACAM5, SLC7A5, MUC1, and CK5/6) test
19365834 Data show that the diagnostic sensitivity and the specificity for TTF-1 were 100%.
19336474 Five new NKX2.1 mutations were identified in patients with brain-lung-thyroid syndrome.
19329538 CEACAM6 in fetal lung epithelial cells is developmentally and hormonally regulated and a target protein for TTF-1
19293183 Findings delineate potential links between TTF-1 and TGF-beta signaling in lung cancer progression through regulation of EMT and MET.
19279207 Coactivation of the TTF-1 and NKX2-8 pathways identified a cluster of lung cancer patients with poor survival and were shown to exhibit resistance to cisplatin
19198613 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
19176457 A missense mutation (1016C>T) was identified in TITF-1/NKX2.1 that led to a mutant TTF-1 protein (A339V) in 4 of the 20 MNG/PTC patients (20%). These patients developed substantially more advanced tumors than MNG/PTC or PTC patients without the mutation
19176457 Observational study of gene-disease association. (HuGE Navigator)
19064983 TTF1 expression defines a subgroup of patients with a favorable outcome and may be useful for prognostic stratification of patients with stage I lung adenocarcinoma.
19047914 TTF 1 immunostaining has the potential to misguide a pathologist to conclude an ovarian or endometrial tumor being a lung metastasis
19040416 Patients with no TTF-1 expression or TTF-1 expression and TTF-1 gene amplification tend to have a significantly worse prognosis than lung cancer patients with TTF-1 expression and no TTF-1 gene amplification
19011567 TTF-1 was found to be positive in 8 of 48 (16.6%) nephroblastomas and negative in all 5 metanephric adenomas.
18997617 Expression of Galectin-3, CD138, p16INK4a, and TTF-1 in mucinous bronchioloalveolar adenocarcinoma after Hodgkin lymphoma.
18958156 The simultaneous positivity for thyroid specific factor TTF-1 and onfFN suggest they might represent putative thyroid cancer stem-like cells.
18957494 a heterozygous TITF1/NKX2.1 mutation leading to neonatal death from respiratory failure.
18932182 study concludes that TTF1 amplification is a mechanism of high-level TTF1 expression in a subset of non-small cell lung carcinomas; when expressed at high levels, it is an independent biomarker of favourable prognosis in adenocarcinoma
18855882 As a molecular marker of detecting pleural micrometastasis, TTF-1 mRNA may be helpful to diagnose the cancer cells in pleural effusion of patients with lung cancer, especially with primary pulmonary adenocarcinoma.
18788921 a NKX2.1 mutation may have a role in hypothyroidism and benign hereditary chorea
18682709 Quantitative reverse transcription-polymerase chain reaction (RT-PCR) showed decreased expression of HNF3 beta/FoxA2 and TTF-1 mRNA in papillary thyroid carcinoma cell lines, when compared with normal thyroid cells
18661567 This study describes the unique phenotypic features and intrafamilial variability expressing this novel mutation in benign hereditary chorea.
18587322 TTF-1 expression was seen in 1 of the 30 Merkel cell carcinomas (3%).
18487360 TTF-1 response element is critical for temporal and spatial regulation and necessary for hormonal regulation of human surfactant protein-A2 promoter activity
18379122 No mutation or polymorphism was detected in the coding region of thyroid transcription factor-1 (TTF-1) gene in Chinese children with congenital hypothyroidism
18379122 Observational study of gene-disease association. (HuGE Navigator)
18355939 In stage III non-small cell lun cancer, there was a significant association between TTF-1 and EGFR or TTF-1 and Mdm2
18246044 TTF-1 nuclear expression is generally considered to be a relatively specific marker for lung and thyroid neoplasms the occasional immunoreactivity of ovarian carcinomas should be considered in the evaluation of neoplasms of unknown primary origin
18239190 Data show that direct interaction between Foxp2 and Nkx2.1 inhibits Nkx2.1 DNA-binding and transcriptional activity and suggest a mechanism for down-regulation of SP-C during transition of AT2 cells to an AT1 cell phenotype.
18212743 TITF1 amplification and overexpression contribute to lung cancer cell proliferation rates and survival
18071837 Data suggest that TTF-1 gene missense mutation and synonymous mutation and the loss of TTF-1 protein and mRNA can be regarded as the important indices of molecular pathology of lung carcinoma.
18059234 Occasional expression of TTF-1 in endometrial and endocervical carcinomas should be kept in mind when evaluating neoplasms of uncertain origin.
17765926 We have identified a new mutation in the TTF-1 coding gene in a patient with benign hereditary chorea. The mutation causes a haploinsufficiency of TITF-1 and opens the question of genotype/phenotype correlation.
17702043 a new splicing mutation (376-2A>C) of the TITF-1 gene was detected in a mother and her daughter in this study.
17671725 Anaplastic thyroid carcinoma tissue express TTF1 mRNA abundantly.
17640327 Observational study of gene-disease association. (HuGE Navigator)
17640327 Met3Leu reduced the activity of the RET promoter by 100% in the presence of the wild-type or HSCR-associated RET promoter SNP alleles.
17616654 TTF-1 expression may be crucial for survival of a subset of adenocarcinomas that express TTF-1, providing credence for the lineage-specific dependency model
17413979 Our results suggest that an immunohistochemical panel consisting of TTF-1, CEA, CA-125, and OCT-4 is helpful in distinguishing most pulmonary and ovarian carcinomas with clear cell features.
17412341 calcitonin gene expression could be directly activated by Nkx2.1, whereas Pax9 is not involved in transcription from the 2kbp calcitonin promoter
17220277 GST-FOXA1 fusion protein interferes with the formation of NKX2.1 transcriptional complexes by potentially masking the latter's homeodomain DNA binding function
17182767 Although morphogenesis of both the pallidum and the hypothalamus requires the presence of transgenic TTF1, only the hypothalamus necessitates the continuous expression of TTF1 to carry out specific differentiated functions.
17044090 New syndromic form of benign hereditary chorea is associated with a deletion of TITF-1 and PAX-9 contiguous genes.
16980598 study supports the fact that TTF-1 could be included in further prospective trials studying prognostic factors in NSCLC
16960125 42-kD TTF-1 is required for induction of a subset of regulated genes during type II cell differentiation.
16630564 Via promoter mutation analysis, adjacent TTF-1 binding sites within the proximal promoter region of SP-C were found to be essential for TTF-1/TAP26-enhanced SP-C promoter activity.
16613858 Erm is involved in SP-C regulation, which results from an interaction with TTF-1
16565516 p23 forms a specific complex with Hsp90 primarily through binding to its middle domain
16461352 PARP-2 and PARP-1 interact with TTF-1 and regulate the expression of surfactant protein B, a protein required for lung function
16314749 Thyroid transcription factor 1 gene is not associated with mental retardation in iodine-deficient areas in China.
16260629 pendrin and thyroglobulin are downstream targets in vivo of TTF-1, whose action is a prime factor in controlling thyroid differentiation in vivo
16220345 a nonsense mutation in the TITF1 gene may be the genetic cause of benign hereditary chorea in a Portuguese family
15955952 Presented is a pedigree with infancy-onset benign hereditary chorea (BHC) caused by a novel nonsense mutation in exon 3 (523G-->T, E175X) of the TITF-1 (Nkx2.1) gene.
15929662 TTF-1 in orbital tissues suggests that it may play an important role in extrathyroidal, as it does in thyroidal, thyrotropin receptor expression
15548547 Observational study of gene-disease association. (HuGE Navigator)
15485815 results demonstrate that interleukin-10 induces uteroglobin related protein 1(UGRP1) gene expression in lung epithelial cells through transcription factor T/EBP/NKX2.1-dependent pathway
15449938 Site-specific mutagenesis identifies that lysine-182 in the TTF-1 homeodomain is acetylated in respiratory epithelial cells. Mutation at this acetylation site shows a dominant negative effect on human surfactant protein B gene transcription.
15279903 nuclear galectin-3 and TTF-1 have roles in progression of non-small cell lung carcinoma
15271884 significantly increased the amount of protein-bound radioiodide and prolonged the iodide efflux
15173172 NFAT and thyroid transcription factor-1 have roles in regulating transcription of the surfactant protein D gene
15098009 TTF-1 immunoreactivity favors a diagnosis of primary thyroid medullary carcinoma over laryngeal moderately differentiated neuroendocrine carcinoma.
14720435 Examination of different immunohistochemical markers including TTF-1 is helpful in the diagnosis and differential diagnosis of pulmonary sclerosing hemangioma.
14633512 Glucocorticoid receptor inhibits SP-A promoter activity through the ttf-1 binding element
12923324 -1 is expressed in pulmonary adenocarcinomas and SCLCs
12499091 nuclear staining of TTF-1 was observed in two of six adenocarcinoma cell lines, none of seven small cell lung cancer cell lines, and none of three squamous lung cancer cell lines
12441357 directly interacts with Pax8 and synergistically activates transcription
12408771 the significance of thyroid transcription factor-1 (TTF-1) in the histogenesis of pulmonary sclerosing hemangioma (PSH)
12161428 Data suggest that SMAD3 interactions with the positive regulators NKX2.1 and HNF-3 underlie the molecular basis for TGF-beta-induced repression of surfactant protein B gene transcription.
12051643 review on use in differentiating neoplasm types
11971878 evidence that mutations in TITF-1 are associated with benign hereditary chorea
11957142 results show that TTF-1 is not expressed in normal and hyperplastic neuroendocrine(NE) cells or in carcinoids, but is expressed in high-grade NE proliferations and in lung adenocarcinomas
11923479 TTF-1 and Pax 8 cooperatively activate their target genes and their synergistic activity requires the cross-talk between enhancer and gene promoter
11854319 the association of symptoms in the patients with NKX2-1 mutations points to an important role of human NKX2-1 in the development and function of thyroid, basal ganglia, and lung, as already described for rodents
11854318 haploinsufficiency of the TTF1 gene results in a predominantly neurological phenotype and secondary hyperthyrotropinemia
11836702 highly sensitive and specific immunomarker distinguishing between metastatic pulmonary and extrapulmonary adenocarcinoma in effusion cytology specimens

AA Sequence

MSMSPKHTTPFSVSDILSPLEESYKKVGMEGGGLGAPLAAYRQGQAAPPTAAMQQHAVGHHGAVTAAYHM      1 - 70
TAAGVPQLSHSAVGGYCNGNLGNMSELPPYQDTMRNSASGPGWYGANPDPRFPAISRFMGPASGMNMSGM     71 - 140
GGLGSLGDVSKNMAPLPSAPRRKRRVLFSQAQVYELERRFKQQKYLSAPEREHLASMIHLTPTQVKIWFQ    141 - 210
NHRYKMKRQAKDKAAQQQLQQDSGGGGGGGGTGCPQQQQAQQQSPRRVAVPVLVKDGKPCQAGAPAPGAA    211 - 280
SLQGHAQQQAQHQAQAAQAAAAAISVGSGGAGLGAHPGHQPGSAGQSPDLAHHAASPAALQGQVSSLSHL    281 - 350
NSSGSDYGTMSCSTLLYGRTW                                                     351 - 371
//

Text Mined References (236)

PMID Year Title
26723978 2016 Functional characterization of two novel mutations in TTF-1/NKX2.1 homeodomain in patients with benign hereditary chorea.
26556242 2015 Integrative Genomics Implicates EGFR as a Downstream Mediator in NKX2-1 Amplified Non-Small Cell Lung Cancer.
26456962 2015 Expression of p63, TTF-1 and Maspin in Non-Small Cell Lung Carcinoma and Their Effect on the Prognosis and Differential Diagnosis.
26356687 2015 Replication and Meta-Analysis of Common Gene Mutations in TTF1 and TTF2 with Papillary Thyroid Cancer.
26337230 2015 Serum microRNA-365 in combination with its target gene TTF-1 as a non-invasive prognostic marker for non-small cell lung cancer.
26316052 2016 Thyroid Transcription Factor-1 Expression in Adenocarcinomas of the Bile Duct.
26247534 2015 Letter to the Editor: Diffuse TTF-1 expression in a case of Merkel cell carcinoma.
26206751 2015 TITF1 and TITF2 loci variants indicate significant associations with thyroid cancer.
26045746 2015 Associations of deregulation of mir-365 and its target mRNA TTF-1 and survival in patients with NSCLC.
25944390 2015 The Value of Cytokeratin 5/6, p63 and Thyroid Transcription Factor-1 in Adenocarcinoma, Squamous Cell Carcinoma and Non-Small-Cell Lung Cancer of the Lung.
25934249 2015 Suprasellar chordoid neoplasm with expression of thyroid transcription factor 1: evidence that chordoid glioma of the third ventricle and pituicytoma may form part of a spectrum of lineage-related tumors of the basal forebrain.
25918229 2015 TTF-1 positive breast cancer: a cautionary tale.
25893822 2015 TTF-1-positive oncocytic sellar tumor with follicle formation/ependymal differentiation: non-adenomatous tumor capable of two different interpretations as a pituicytoma or a spindle cell oncocytoma.
25889870 2015 Value of thyroid transcription factor (TTF)-1 for diagnosis and prognosis of patients with locally advanced or metastatic small cell lung cancer.
25881545 2015 NKX2-1-mediated p53 expression modulates lung adenocarcinoma progression via modulating IKK?/NF-?B activation.
25854394 2015 Thyroid transcription factor-1 expression in advanced non- small cell lung cancer: impact on survival outcome.
25733373 2015 Diagnostic and prognostic significances of MUC5B and TTF-1 expressions in resected non-small cell lung cancer.
25426816 2015 Inherited progressive cardiac conduction disorders.
25425970 2014 Up-regulation of FOXM1 by E6 oncoprotein through the MZF1/NKX2-1 axis is required for human papillomavirus-associated tumorigenesis.
25412988 2015 Recurrent drop attacks in early childhood as presenting symptom of benign hereditary chorea caused by TITF1 gene mutations.
25337222 2014 A fine decision tree consisted of CK5/6, IMP3 and TTF1 for cytological diagnosis among reactive mesothelial cells, metastatic adenocarcinoma of lung and non-lung origin in pleural effusion.
25247229 2014 TTF-1 positivity in 2 cases of adenocarcinoma of the gastrointestinal tract.
25063315 2014 Analysis of clinical characteristics and differential diagnosis of the lung biopsy specimens in 99 adenocarcinoma cases and 111 squamous cell carcinoma cases: utility of an immunohistochemical panel containing CK5/6, CK34?E12, p63, CK7 and TTF-1.
25060702 2014 A Smad3 and TTF-1/NKX2-1 complex regulates Smad4-independent gene expression.
24930029 2014 A novel de novo mutation of the TITF1/NKX2-1 gene causing ataxia, benign hereditary chorea, hypothyroidism and a pituitary mass in a UK family and review of the literature.
24913303 2014 TTF-1 may not be a reliable marker for differentiating metastasis from brain tumors.
24901475 2014 Loss of cytokeratin 20 and acquisition of thyroid transcription factor-1 expression in a merkel cell carcinoma metastasis to the brain.
24778062 2014 Influence of thyroid transcription factor-1 on fluorodeoxyglucose uptake and prognosis of non-small cell lung cancer.
24743427 2014 The relationship between TTF-1 expression and EGFR mutations in lung adenocarcinomas.
24714694 2014 Comprehensive genotyping and clinical characterisation reveal 27 novel NKX2-1 mutations and expand the phenotypic spectrum.
24689794 2015 Evaluation of the microvessel density and the expression of metalloproteases 2 and 9 and ttf1 in the different subtypes of lung adenocarcinoma in Tunisia: a retrospective study of 46 cases.
24594201 2014 Spectrum of somatic EGFR, KRAS, BRAF, PTEN mutations and TTF-1 expression in Brazilian lung cancer patients.
24457236 2013 Associations between TS, TTF-1, FR-?, FPGS, and overall survival in patients with advanced non-small-cell lung cancer receiving pemetrexed plus carboplatin or gemcitabine plus carboplatin as first-line chemotherapy.
24453141 2014 A novel mutation of NKX2-1 affecting 2 generations with hypothyroidism and choreoathetosis: part of the spectrum of brain-thyroid-lung syndrome.
24452548 2014 Are the SNPs of NKX2-1 associated with papillary thyroid carcinoma in the Han population of Northern China?
24418856 2014 TTF-1 and Napsin-A are expressed in a subset of cholangiocarcinomas arising from the gallbladder and hepatic ducts: continued caveats for utilization of immunohistochemistry panels.
24370340 2014 Genotype-phenotype correlation in Chinese patients with pulmonary mixed type adenocarcinoma: Relationship between histologic subtypes, TITF-1/SP-A expressions and EGFR mutations.
24331839 2014 Immunohistochemical study of 36 cases of pulmonary sarcomatoid carcinoma--sensitivity of TTF-1 is superior to napsin.
24267480 2014 Thyroid transcription factor-1 (TTF-1) immunoreactivity is an adverse prognostic factor in endometrioid adenocarcinoma of the uterine corpus.
24207093 2013 Role of thyroid transcription factor-1 and P63 immunocytochemistry in cytologic typing of non-small cell lung carcinomas.
24171694 2014 Benign hereditary chorea related to NKX2.1: expansion of the genotypic and phenotypic spectrum.
24129101 2014 NKX2-1 mutations in brain-lung-thyroid syndrome: a case series of four patients.
24111789 2014 TTF-1 expression in breast carcinoma: an unusual but real phenomenon.
24051510 2013 Molecular and gene network analysis of thyroid transcription factor 1 (TTF1) and enhanced at puberty (EAP1) genes in patients with GnRH-dependent pubertal disorders.
24014739 2013 Concurrent overexpression of RET/PTC1 and TTF1 confers tumorigenicity to thyrocytes.
23995788 2014 LKB1 loss by alteration of the NKX2-1/p53 pathway promotes tumor malignancy and predicts poor survival and relapse in lung adenocarcinomas.
23988776 2014 EGFR, KRAS, BRAF and ALK gene alterations in lung adenocarcinomas: patient outcome, interplay with morphology and immunophenotype.
23958551 2014 In search of the ideal immunopanel to distinguish metastatic mammary carcinoma from primary lung carcinoma: a tissue microarray study of 207 cases.
23911641 2013 NKX2-1 mutation in a family diagnosed with ataxic dyskinetic cerebral palsy.
23899066 2013 TTF-1 and napsin A do not differentiate metastatic lung adenocarcinomas from primary esophageal adenocarcinomas: proposal of a novel staining panel.
23818522 2013 The complexity of thyroid transcription factor 1 with both pro- and anti-oncogenic activities.
23787483 2013 A mutation in TTF1/NKX2.1 is associated with familial neuroendocrine cell hyperplasia of infancy.
23787439 2013 Comparative immunohistochemical analysis of pulmonary and thymic neuroendocrine carcinomas using PAX8 and TTF-1.
23763999 2013 NKX2-1/TTF-1: an enigmatic oncogene that functions as a double-edged sword for cancer cell survival and progression.
23675755 2013 Expression of thyroid transcription factor-1 is associated with a basal-like phenotype in breast carcinomas.
23667675 2013 Genome wide association study of age at menarche in the Japanese population.
23658034 2013 [Chorea due to TITF1/NKX2-1 mutation: phenotypical description and therapeutic response in a family].
23637834 2013 Ectopic expression of homeobox gene NKX2-1 in diffuse large B-cell lymphoma is mediated by aberrant chromatin modifications.
23625920 2013 MicroRNA-33a mediates the regulation of high mobility group AT-hook 2 gene (HMGA2) by thyroid transcription factor 1 (TTF-1/NKX2-1).
23525704 2013 EGFR and TTF-1 gene amplification in surgically resected lung adenocarcinomas: clinicopathologic significance and effect on response to EGFR-tyrosine kinase inhibitors in recurred cases.
23514941 2013 [Expression and clinical significance of the thyroid transcription factor 1 in Xuanwei lung adenocarcinoma].
23507558 2013 MicroRNA-365 regulates NKX2-1, a key mediator of lung cancer.
23418554 2013 Simultaneous multi-antibody staining in non-small cell lung cancer strengthens diagnostic accuracy especially in small tissue samples.
23382074 2013 A high-confidence interaction map identifies SIRT1 as a mediator of acetylation of USP22 and the SAGA coactivator complex.
23379327 2013 Identification and functional characterization of a novel mutation in the NKX2-1 gene: comparison with the data in the literature.
23361500 2013 Novel NKX2.1 mutation associated with hypothyroidism and lethal respiratory failure in a full-term neonate.
23358112 2013 Neural lineage-specific homeoprotein BRN2 is directly involved in TTF1 expression in small-cell lung cancer.
23330966 2013 Expression of focal TTF-1 expression in a case of CK7/CK20-positive Merkel cell carcinoma.
23322301 2013 Integrated cistromic and expression analysis of amplified NKX2-1 in lung adenocarcinoma identifies LMO3 as a functional transcriptional target.
23259454 2013 NKX2-1 activation by SMAD2 signaling after definitive endoderm differentiation in human embryonic stem cell.
23169673 2012 Choreoathetosis, congenital hypothyroidism and neonatal respiratory distress syndrome with intact NKX2-1.
23143308 2012 Kras(G12D) and Nkx2-1 haploinsufficiency induce mucinous adenocarcinoma of the lung.
23125078 2012 Nkx2-1: a novel tumor biomarker of lung cancer.
22982653 2012 Negative NKX2-1 (TTF-1) as temporary surrogate marker for treatment selection during EGFR-mutation analysis in patients with non-small-cell lung cancer.
22959176 2013 Benign hereditary chorea: clinical features and long-term follow-up in a Spanish family.
22940844 2012 Thyroid transcription factor 1 represses the expression of Ki-67 and induces apoptosis in non-small cell lung cancer.
22832740 2012 Benign hereditary chorea: phenotype, prognosis, therapeutic outcome and long term follow-up in a large series with new mutations in the TITF1/NKX2-1 gene.
22825795 2013 Benign hereditary chorea: dopaminergic brain imaging in patients with a novel intronic NKX2.1 gene mutation.
22761434 2012 Occludin is a direct target of thyroid transcription factor-1 (TTF-1/NKX2-1).
22531686 2012 Thyroid transcription factor-1 is not expressed in squamous cell carcinomas of the lung: an immunohistochemical study with review of the literature.
22495359 2012 IMP3, NESP55, TTF-1 and CDX2 serve as an immunohistochemical panel in the distinction among small-cell carcinoma, gastrointestinal carcinoid, and pancreatic endocrine tumor metastasized to the liver.
22460811 2012 Expression of thyroid transcription factor-1 in normal endometrium is associated with risk of endometrial cancer development.
22439932 2012 NKX2-1/TITF1/TTF-1-Induced ROR1 is required to sustain EGFR survival signaling in lung adenocarcinoma.
22383183 2012 Opposite roles of FOXA1 and NKX2-1 in lung cancer progression.
22242187 2012 Genome-wide analyses of Nkx2-1 binding to transcriptional target genes uncover novel regulatory patterns conserved in lung development and tumors.
22237264 2012 High incidence of EGFR mutations in Korean men smokers with no intratumoral heterogeneity of lung adenocarcinomas: correlation with histologic subtypes, EGFR/TTF-1 expressions, and clinical features.
22185756 2012 MiR-365 regulates lung cancer and developmental gene thyroid transcription factor 1.
22166853 2012 Hypoperfusion in caudate nuclei in patients with brain-lung-thyroid syndrome.
22085929 2012 MYBPH, a transcriptional target of TTF-1, inhibits ROCK1, and reduces cell motility and metastasis.
22011671 2012 Thyroid transcription factor-1 amplification and expressions in lung adenocarcinoma tissues and pleural effusions predict patient survival and prognosis.
21982616 2012 A novel nonsense mutation in the TITF-1 gene in a Japanese family with benign hereditary chorea.
21838611 2012 Diagnostic utility of PAX8, TTF-1 and napsin A for discriminating metastatic carcinoma from primary adenocarcinoma of the lung.
21836499 2014 Follicular dendritic cell sarcoma of the head and neck expressing thyroid transcription factor-1: a case report with clinicopathologic and immunohistochemical literature review.
21836486 2011 TTF-1 in embryonal tumors: an immunohistochemical study of 117 cases.
21813802 2012 Brain-lung-thyroid disease: clinical features of a kindred with a novel thyroid transcription factor 1 mutation.
21784970 2011 Thyroid transcription factor-1 (TTF-1) gene: identification of ZBP-89, Sp1, and TTF-1 sites in the promoter and regulation by TNF-? in lung epithelial cells.
21775107 2011 Merkel cell carcinoma with cytokeratin 20-negative and thyroid transcription factor-1-positive immunostaining admixed with squamous cell carcinoma.
21771032 2011 Thyroid transcription factor-1 expression in rare cases of mammary ductal carcinoma.
21730105 2011 The FOXE1 and NKX2-1 loci are associated with susceptibility to papillary thyroid carcinoma in the Japanese population.
21717589 2011 Comparison of the expression levels of napsin A, thyroid transcription factor-1, and p63 in nonsmall cell lung cancer using cytocentrifuged bronchial brushings.
21716147 2011 Significance of thymidylate synthase and thyroid transcription factor 1 expression in patients with nonsquamous non-small cell lung cancer treated with pemetrexed-based chemotherapy.
21677782 2011 HOXB5 cooperates with NKX2-1 in the transcription of human RET.
21562130 2011 Airway epithelial transcription factor NK2 homeobox 1 inhibits mucous cell metaplasia and Th2 inflammation.
21555194 2012 TITF-1 gene mutation in a case of sporadic non-progressive chorea. Response to levodopa treatment.
21481790 2011 Integrated transcript and genome analyses reveal NKX2-1 and MEF2C as potential oncogenes in T cell acute lymphoblastic leukemia.
21471965 2011 Suppression of lung adenocarcinoma progression by Nkx2-1.
21464700 2011 Combination of napsin A and TTF-1 immunohistochemistry helps in differentiating primary lung adenocarcinoma from metastatic carcinoma in the lung.
21425409 2011 A targeted NKX2.1 human embryonic stem cell reporter line enables identification of human basal forebrain derivatives.
21343336 2011 Upregulation of thyroid transcription factor-1 and human leukocyte antigen class I in Hashimoto's disease providing a clinical evidence for possible triggering autoimmune reaction.
21257719 2011 Abnormalities of the TITF-1 lineage-specific oncogene in NSCLC: implications in lung cancer pathogenesis and prognosis.
21203907 2011 Immunohistochemical profile of urothelial and small cell carcinomas of the bladder.
21164283 2011 Subclassification of non-small cell lung carcinomas lacking morphologic differentiation on biopsy specimens: Utility of an immunohistochemical panel containing TTF-1, napsin A, p63, and CK5/6.
21036415 2011 Frequent ALK rearrangement and TTF-1/p63 co-expression in lung adenocarcinoma with signet-ring cell component.
20848248 2011 Expression of thyroid transcription factor-1 in malignant pleural effusions.
20830690 2010 The utility of napsin-A in the identification of primary and metastatic lung adenocarcinoma among cytologically poorly differentiated carcinomas.
20823767 2011 Thymoma with nuclear expression of thyroid transcription factor-1: a potential diagnostic pitfall on core biopsy.
20734064 2010 A large-scale candidate gene association study of age at menarche and age at natural menopause.
20701785 2010 Lack of germline A339V mutation in thyroid transcription factor-1 (TITF-1/NKX2.1) gene in familial papillary thyroid cancer.
20565809 2010 Thyroid transcription factor-1 positive primary breast cancer: a case report with review of the literature.
20518411 Utility of thyroid transcription factor-1 and CDX-2 in determining the primary site of metastatic adenocarcinomas in serous effusions.
20471712 2011 TTF-1 mRNA-positive circulating tumor cells in the peripheral blood predict poor prognosis in surgically resected non-small cell lung cancer patients.
20302910 2010 Genetics and phenomics of hypothyroidism and thyroid dys- and agenesis due to PAX8 and TTF1 mutations.
20182342 2010 An immunohistochemical study of cervical neuroendocrine carcinomas: Neoplasms that are commonly TTF1 positive and which may express CK20 and P63.
20157192 2010 Transcription factor mutations and congenital hypothyroidism: systematic genetic screening of a population-based cohort of Japanese patients.
20042854 2010 Expression of thyroid transcription factor-1 in colorectal carcinoma.
20020530 2010 NKX2-1 mutations leading to surfactant protein promoter dysregulation cause interstitial lung disease in "Brain-Lung-Thyroid Syndrome".
19906647 2010 Epigenetic mechanisms modulate thyroid transcription factor 1-mediated transcription of the surfactant protein B gene.
19740516 2010 Napsin A and thyroid transcription factor-1 expression in carcinomas of the lung, breast, pancreas, colon, kidney, thyroid, and malignant mesothelioma.
19730683 2009 The variant rs1867277 in FOXE1 gene confers thyroid cancer susceptibility through the recruitment of USF1/USF2 transcription factors.
19578049 2009 Thyroid transcription factor-1 and "basal marker"--expressing small cell carcinoma of the breast.
19525896 2009 Thyroid transcription factor 1 expression in sellar tumors: a histogenetic marker?
19506552 2009 Epigenetic silencing of TTF-1/NKX2-1 through DNA hypermethylation and histone H3 modulation in thyroid carcinomas.
19483637 2009 Thyroid transcription factor-1 expression in normal gynecologic tissues and its potential significance.
19464057 2009 A high-throughput candidate gene mutation screen in lymphoproliferative and myeloproliferative neoplasias.
19430419 2009 A novel five-antibody immunohistochemical test for subclassification of lung carcinoma.
19365834 2009 A technique to improve diagnostic information from fine-needle aspirations: immunohistochemistry on cytoscrape.
19336474 2009 Five new TTF1/NKX2.1 mutations in brain-lung-thyroid syndrome: rescue by PAX8 synergism in one case.
19329538 2009 Carcinoembryonic cell adhesion molecule 6 in human lung: regulated expression of a multifunctional type II cell protein.
19293183 2009 Thyroid transcription factor-1 inhibits transforming growth factor-beta-mediated epithelial-to-mesenchymal transition in lung adenocarcinoma cells.
19279207 2009 Characterizing the developmental pathways TTF-1, NKX2-8, and PAX9 in lung cancer.
19198613 2009 Common variants on 9q22.33 and 14q13.3 predispose to thyroid cancer in European populations.
19176457 2009 A germline mutation (A339V) in thyroid transcription factor-1 (TITF-1/NKX2.1) in patients with multinodular goiter and papillary thyroid carcinoma.
19064983 2009 Thyroid transcription factor 1 is an independent prognostic factor for patients with stage I lung adenocarcinoma.
19047914 2009 TTF-1 expression in ovarian and uterine epithelial neoplasia and its potential significance, an immunohistochemical assessment with multiple monoclonal antibodies and different secondary detection systems.
19040416 2009 Clinical significance of TTF-1 protein expression and TTF-1 gene amplification in lung adenocarcinoma.
19011567 2009 TTF-1 expression in nephroblastoma.
19010321 2009 TAZ is a coactivator for Pax8 and TTF-1, two transcription factors involved in thyroid differentiation.
18997617 2009 Expression of Galectin-3, CD138, p16INK4a, and TTF-1 in mucinous bronchioloalveolar adenocarcinoma after Hodgkin lymphoma.
18958156 2008 In vitro identification and characterization of CD133(pos) cancer stem-like cells in anaplastic thyroid carcinoma cell lines.
18957494 2009 Lethal respiratory failure and mild primary hypothyroidism in a term girl with a de novo heterozygous mutation in the TITF1/NKX2.1 gene.
18932182 2009 TTF1 expression in non-small cell lung carcinoma: association with TTF1 gene amplification and improved survival.
18855882 2008 Transcription expression and clinical significance of TTF-1 mRNA in pleural effusion of patients with lung cancer.
18788921 2008 A novel NKX2.1 mutation in a family with hypothyroidism and benign hereditary chorea.
18682709 2008 Induction of sodium iodide symporter gene and molecular characterisation of HNF3 beta/FoxA2, TTF-1 and C/EBP beta in thyroid carcinoma cells.
18661567 2008 Psychosis, short stature in benign hereditary chorea: a novel thyroid transcription factor-1 mutation.
18587322 2008 MASH1: a useful marker in differentiating pulmonary small cell carcinoma from Merkel cell carcinoma.
18487360 2008 TTF-1 response element is critical for temporal and spatial regulation and necessary for hormonal regulation of human surfactant protein-A2 promoter activity.
18391950 2008 Identification of ten loci associated with height highlights new biological pathways in human growth.
18379122 2008 Thyrotropin receptor and thyroid transcription factor-1 genes variant in Chinese children with congenital hypothyroidism.
18355939 2008 EGFR, TTF-1 and Mdm2 expression in stage III non-small cell lung cancer: a positive association.
18246044 2008 Thyroid transcription factor-1 expression in ovarian epithelial neoplasms.
18239190 2008 Foxp2 inhibits Nkx2.1-mediated transcription of SP-C via interactions with the Nkx2.1 homeodomain.
18212743 2008 Genomic profiling identifies TITF1 as a lineage-specific oncogene amplified in lung cancer.
18071837 Mutational analysis of thyroid transcription factor-1 gene (TTF-1) in lung carcinomas.
18059234 2007 Thyroid transcription factor-1 expression in endometrial and endocervical adenocarcinomas.
17765926 2008 Functional characterization of a novel mutation in TITF-1 in a patient with benign hereditary chorea.
17702043 2007 Clinical differentiation of genetically proven benign hereditary chorea and myoclonus-dystonia.
17671725 2007 Quantitative measurement of telomerase reverse transcriptase, thyroglobulin and thyroid transcription factor 1 mRNAs in anaplastic thyroid carcinoma tissues and cell lines.
17640327 2007 Evaluation of the thyroid transcription factor-1 gene (TITF1) as a Hirschsprung's disease locus.
17616654 2007 Lineage-specific dependency of lung adenocarcinomas on the lung development regulator TTF-1.
17474147 2007 Systematic identification of SH3 domain-mediated human protein-protein interactions by peptide array target screening.
17413979 2007 Carcinomas of ovary and lung with clear cell features: can immunohistochemistry help in differential diagnosis?
17412341 Functional analysis of Nkx2.1 and Pax9 for calcitonin gene transcription.
17220277 2007 Physical and functional interactions between homeodomain NKX2.1 and winged helix/forkhead FOXA1 in lung epithelial cells.
17182767 2006 Deletion of the Ttf1 gene in differentiated neurons disrupts female reproduction without impairing basal ganglia function.
17044090 2006 New syndromic form of benign hereditary chorea is associated with a deletion of TITF-1 and PAX-9 contiguous genes.
16980598 2006 Thyroid transcription factor 1--a new prognostic factor in lung cancer: a meta-analysis.
16960125 2007 Thyroid transcription factor in differentiating type II cells: regulation, isoforms, and target genes.
16630564 2006 The TTF-1/TAP26 complex differentially modulates surfactant protein-B (SP-B) and -C (SP-C) promoters in lung cells.
16613858 2006 Erm/thyroid transcription factor 1 interactions modulate surfactant protein C transcription.
16565516 2006 Localization of sites of interaction between p23 and Hsp90 in solution.
16461352 2006 PARP-2 interacts with TTF-1 and regulates expression of surfactant protein-B.
16314749 2005 Lack of association of the thyroid transcription factor 1 gene with mental retardation in the iodine-deficient areas of China.
16260629 2005 Pendrin is a novel in vivo downstream target gene of the TTF-1/Nkx-2.1 homeodomain transcription factor in differentiated thyroid cells.
16220345 2005 Nonsense mutation in TITF1 in a Portuguese family with benign hereditary chorea.
15955952 2005 A novel TITF-1 mutation causes benign hereditary chorea with response to levodopa.
15929662 2005 Thyroid transcription factor-1 in orbital adipose tissues: potential role in orbital thyrotropin receptor expression.
15548547 2005 TTF-1 and RET promoter SNPs: regulation of RET transcription in Hirschsprung's disease.
15494458 2005 PAX8, TITF1, and FOXE1 gene expression patterns during human development: new insights into human thyroid development and thyroid dysgenesis-associated malformations.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15485815 2004 Interleukin-10 induces uteroglobin-related protein (UGRP) 1 gene expression in lung epithelial cells through homeodomain transcription factor T/EBP/NKX2.1.
15449938 2004 Mutation of a lysine residue in a homeodomain generates dominant negative thyroid transcription factor 1.
15289765 2004 Autosomal dominant transmission of congenital hypothyroidism, neonatal respiratory distress, and ataxia caused by a mutation of NKX2-1.
15279903 2004 Galectin-3 expression in non-small cell lung carcinoma.
15271884 2004 Adenovirus-mediated transfer of thyroid transcription factor-1 induces radioiodide organification and retention in thyroid cancer cells.
15173172 2004 Nuclear factor of activated T cells regulates transcription of the surfactant protein D gene (Sftpd) via direct interaction with thyroid transcription factor-1 in lung epithelial cells.
15098009 2004 Thyroid transcription factor-1, but not p53, is helpful in distinguishing moderately differentiated neuroendocrine carcinoma of the larynx from medullary carcinoma of the thyroid.
14970209 2004 TAZ interacts with TTF-1 and regulates expression of surfactant protein-C.
14960358 2004 NKX2.1 regulates transcription of the gene for human bone morphogenetic protein-4 in lung epithelial cells.
14720435 2003 [Biologic significance of thyroid transcription factor-1 and surfactant protein expression in pulmonary sclerosing hemangioma].
14633512 2004 Glucocorticoid inhibition of SP-A gene expression in lung type II cells is mediated via the TTF-1-binding element.
12923324 2003 Thyroid transcription factor-1 (TTF-1) expression in human lung carcinomas: its prognostic implication and relationship with wxpressions of p53 and Ki-67 proteins.
12684771 2003 Pulmonary well-differentiated fetal adenocarcinoma expressing lineage-specific transcription factors (TTF-1 and GATA-6) to respiratory epithelial differentiation: an immunohistochemical and ultrastructural study.
12508121 2003 The DNA sequence and analysis of human chromosome 14.
12499091 2003 Expression of thyroid transcription factor-1 in 16 human lung cancer cell lines.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12441357 2003 The paired domain-containing factor Pax8 and the homeodomain-containing factor TTF-1 directly interact and synergistically activate transcription.
12408771 2002 Thyroid transcription factor-1 in the histogenesis of plumonary sclerosing hemangioma.
12161428 2002 Transforming growth factor-beta inhibits pulmonary surfactant protein B gene transcription through SMAD3 interactions with NKX2.1 and HNF-3 transcription factors.
12051643 2002 Thyroid transcription factor-1: a review.
12040027 2002 Potential role of nuclear factor kappaB and reactive oxygen species in cAMP and cytokine regulation of surfactant protein-A gene expression in lung type II cells.
11971878 2002 Mutations in TITF-1 are associated with benign hereditary chorea.
11953175 2002 [Expression of TTF-1 in thyroid tumors originating from follicular epithelium and its correlation with expression of RET, galectin-3 and mucin-1 genes].
11923479 2002 The synergistic activity of thyroid transcription factor 1 and Pax 8 relies on the promoter/enhancer interplay.
11854319 2002 Choreoathetosis, hypothyroidism, and pulmonary alterations due to human NKX2-1 haploinsufficiency.
11854318 2002 Partial deficiency of thyroid transcription factor 1 produces predominantly neurological defects in humans and mice.
11733512 2002 GATA-6 and thyroid transcription factor-1 directly interact and regulate surfactant protein-C gene expression.
11713256 2002 Role of CBP/p300 and SRC-1 in transcriptional regulation of the pulmonary surfactant protein-A (SP-A) gene by thyroid transcription factor-1 (TTF-1).
11438542 2001 The DNA glycosylase T:G mismatch-specific thymine DNA glycosylase represses thyroid transcription factor-1-activated transcription.
11274148 2001 Protein-protein interaction of retinoic acid receptor alpha and thyroid transcription factor-1 in respiratory epithelial cells.
11152647 2001 BR22, a novel protein, interacts with thyroid transcription factor-1 and activates the human surfactant protein B promoter.
11076796 2000 Temporal/spatial expression of nuclear receptor coactivators in the mouse lung.
10733581 2000 Multiple ras downstream pathways mediate functional repression of the homeobox gene product TTF-1.
10617585 2000 Retinoic acid stimulation of the human surfactant protein B promoter is thyroid transcription factor 1 site-dependent.
9988700 1999 Calreticulin enhances the transcriptional activity of thyroid transcription factor-1 by binding to its homeodomain.
9545595 1998 Structure of the human Nkx2.1 gene.
9396717 1997 Nuclear localization domain of thyroid transcription factor-1 in respiratory epithelial cells.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
8675988 1996 Expression of thyroid transcription factor-1(TTF-1) in fetal and neonatal human lung.
7713914 1995 Gene structure and expression of human thyroid transcription factor-1 in respiratory epithelial cells.
7711080 1995 Cloning and sequence analysis of human thyroid transcription factor 1.
7711079 1995 The complete nucleotide sequence of the mouse thyroid-specific enhancer-binding protein (T/EBP) gene: extensive identity of the deduced amino acid sequence with the human protein.
7635972 1995 Congenital human thyroglobulin defect due to low expression of the thyroid-specific transcription factor TTF-1.
7559607 1995 Upstream enhancer activity in the human surfactant protein B gene is mediated by thyroid transcription factor 1.
1976511 1990 Thyroid nuclear factor 1 (TTF-1) contains a homeodomain and displays a novel DNA binding specificity.
1735431 1992 Functional study of the human thyroid peroxidase gene promoter.