Property Summary

NCBI Gene PubMed Count 9
PubMed Score 46.07
PubTator Score 68.84

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (24)

Disease log2 FC p
Rheumatoid Arthritis 1.700 3.1e-02
gastric cancer -1.100 4.3e-04
pancreatic cancer -1.200 2.4e-04
astrocytic glioma 1.600 5.9e-03
ependymoma 1.400 2.5e-02
oligodendroglioma 1.500 9.4e-04
psoriasis -1.500 1.2e-04
osteosarcoma 2.606 6.0e-08
atypical teratoid / rhabdoid tumor 1.200 7.6e-03
acute quadriplegic myopathy 1.035 2.6e-06
tuberculosis and treatment for 6 months 1.200 1.0e-05
pancreatic ductal adenocarcinoma liver m... 1.529 4.1e-02
intraductal papillary-mucinous adenoma (... 1.800 2.0e-03
intraductal papillary-mucinous carcinoma... 1.600 1.3e-02
intraductal papillary-mucinous neoplasm ... 1.400 4.1e-03
sarcoidosis 1.100 6.7e-03
adult high grade glioma 1.400 9.1e-03
pancreatic carcinoma -1.200 2.4e-04
acute myeloid leukemia 1.600 2.6e-02
Pick disease -2.100 6.3e-06
progressive supranuclear palsy -1.900 4.9e-03
Breast cancer -1.800 1.4e-28
ovarian cancer 2.600 4.6e-06
pituitary cancer -1.300 2.6e-04

Gene RIF (1)

PMID Text
18976975 Knockdown of natural killer-tumor recognition sequence (NKTR) by siRNA inhibits HIV-1 replication in HeLa P4/R5 cells

AA Sequence

MGAQDRPQCHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGEKGLGKTTGKKLCYKGSTFHRVVKN      1 - 70
FMIQGGDFSEGNGKGGESIYGGYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVF     71 - 140
GLVISGFEVIEQIENLKTDAASRPYADVRVIDCGVLATKSIKDVFEKKRKKPTHSEGSDSSSNSSSSSES    141 - 210
SSESELEHERSRRRKHKRRPKVKRSKKRRKEASSSEEPRNKHAMNPKGHSERSDTNEKRSVDSSAKREKP    211 - 280
VVRPEEIPPVPENRFLLRRDMPVVTAEPEPKIPDVAPIVSDQKPSVSKSGRKIKGRGTIRYHTPPRSRSC    281 - 350
SESDDDDSSETPPHWKEEMQRLRAYRPPSGEKWSKGDKLSDPCSSRWDERSLSQRSRSWSYNGYYSDLST    351 - 420
ARHSGHHKKRRKEKKVKHKKKGKKQKHCRRHKQTKKRRILIPSDIESSKSSTRRMKSSCDRERSSRSSSL    421 - 490
SSHHSSKRDWSKSDKDVQSSLTHSSRDSYRSKSHSQSYSRGSSRSRTASKSSSHSRSRSKSRSSSKSGHR    491 - 560
KRASKSPRKTASQLSENKPVKTEPLRATMAQNENVVVQPVVAENIPVIPLSDSPPPSRWKPGQKPWKPSY    561 - 630
ERIQEMKAKTTHLLPIQSTYSLANIKETGSSSSYHKREKNSESDQSTYSKYSDRSSESSPRSRSRSSRSR    631 - 700
SYSRSYTRSRSLASSHSRSRSPSSRSHSRNKYSDHSQCSRSSSYTSISSDDGRRAKRRLRSSGKKNSVSH    701 - 770
KKHSSSSEKTLHSKYVKGRDRSSCVRKYSESRSSLDYSSDSEQSSVQATQSAQEKEKQGQMERTHNKQEK    771 - 840
NRGEEKSKSERECPHSKKRTLKENLSDHLRNGSKPKRKNYAGSKWDSESNSERDVTKNSKNDSHPSSDKE    841 - 910
EGEATSDSESEVSEIHIKVKPTTKSSTNTSLPDDNGAWKSSKQRTSTSDSEGSCSNSENNRGKPQKHKHG    911 - 980
SKENLKREHTKKVKEKLKGKKDKKHKAPKRKQAFHWQPPLEFGEEEEEEIDDKQVTQESKEKKVSENNET    981 - 1050
IKDNILKTEKSSEEDLSGKHDTVTVSSDLDQFTKDDSKLSISPTALNTEENVACLQNIQHVEESVPNGVE   1051 - 1120
DVLQTDDNMEICTPDRSSPAKVEETSPLGNARLDTPDINIVLKQDMATEHPQAEVVKQESSMSESKVLGE   1121 - 1190
VGKQDSSSASLASAGESTGKKEVAEKSQINLIDKKWKPLQGVGNLAAPNAATSSAVEVKVLTTVPEMKPQ   1191 - 1260
GLRIEIKSKNKVRPGSLFDEVRKTARLNRRPRNQESSSDEQTPSRDDDSQSRSPSRSRSKSETKSRHRTR   1261 - 1330
SVSYSHSRSRSRSSTSSYRSRSYSRSRSRGWYSRGRTRSRSSSYRSYKSHRTSSRSRSRSSSYDPHSRSR   1331 - 1400
SYTYDSYYSRSRSRSRSQRSDSYHRGRSYNRRSRSCRSYGSDSESDRSYSHHRSPSESSRYS           1401 - 1462
//

Text Mined References (19)

PMID Year Title
25772364 2015 SUMO-2 Orchestrates Chromatin Modifiers in Response to DNA Damage.
25755297 2015 System-wide Analysis of SUMOylation Dynamics in Response to Replication Stress Reveals Novel Small Ubiquitin-like Modified Target Proteins and Acceptor Lysines Relevant for Genome Stability.
25218447 2014 Uncovering global SUMOylation signaling networks in a site-specific manner.
25114211 2014 Mapping of SUMO sites and analysis of SUMOylation changes induced by external stimuli.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
14729963 2004 Human RNPS1 and its associated factors: a versatile alternative pre-mRNA splicing regulator in vivo.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
8421688 1993 A cyclophilin-related protein involved in the function of natural killer cells.
8413330 1993 IL-2 regulates the expression of the NK-TR gene via an alternate RNA splicing mechanism.
8314596 1993 Localization of a novel natural killer triggering receptor locus to human chromosome 3p23-p21 and mouse chromosome 9.
8144875 1994 Expression of the NK-TR gene is required for NK-like activity in human T cells.
1720812 1991 Mechanism of target cell recognition by natural killer cells: characterization of a novel triggering molecule restricted to CD3- large granular lymphocytes.