Property Summary

NCBI Gene PubMed Count 8
PubMed Score 2.22
PubTator Score 1.84

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
group 4 medulloblastoma 1.700 1.5e-08
atypical teratoid / rhabdoid tumor 1.200 8.5e-08
medulloblastoma, large-cell 1.700 2.4e-06
primitive neuroectodermal tumor 1.300 6.4e-05
lung cancer 1.300 5.3e-04
acute myeloid leukemia 1.200 2.0e-03
ovarian cancer 1.100 8.7e-05

Synonym

Accession Q9NYR9 A6NCZ5 B3KNN0 B4DNM3 Q6PK52 Q96KC7 Q9NSX1
Symbols KBRAS2
kappaB-Ras2

Gene

  Ortholog (1)

Species Source Disease
Macaque OMA Inparanoid

Gene RIF (3)

PMID Text
24901050 GBM cells overexpressing TNFAIP3 and NKIRAS2 were refractory to miR-125b-induced apoptosis resistance as well as TMZ resistance, indicating that both genes are relevant targets of miR-125b.
20639196 KappaB-Ras2 is a nuclear-cytoplasmic small GTPase that inhibits NF-kappaB activation through the suppression of transcriptional activation of p65/RelA.
18434448 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MGKSCKVVVCGQASVGKTSILEQLLYGNHVVGSEMIETQEDIYVGSIETDRGVREQVRFYDTRGLRDGAE      1 - 70
LPRHCFSCTDGYVLVYSTDSRESFQRVELLKKEIDKSKDKKEVTIVVLGNKCDLQEQRRVDPDVAQHWAK     71 - 140
SEKVKLWEVSVADRRSLLEPFVYLASKMTQPQSKSAFPLSRKNKGSGSLDG                       141 - 191
//

Text Mined References (11)

PMID Year Title
24901050 2014 miR-125b controls apoptosis and temozolomide resistance by targeting TNFAIP3 and NKIRAS2 in glioblastomas.
21269460 2011 Initial characterization of the human central proteome.
20639196 2010 KappaB-Ras is a nuclear-cytoplasmic small GTPase that inhibits NF-kappaB activation through the suppression of transcriptional activation of p65/RelA.
18434448 2009 Genetic variation in the nuclear factor kappaB pathway in relation to susceptibility to rheumatoid arthritis.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16625196 2006 DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10657303 2000 A subclass of Ras proteins that regulate the degradation of IkappaB.