Property Summary

NCBI Gene PubMed Count 5
PubMed Score 9.71
PubTator Score 11.23

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (10)

Disease log2 FC p
cutaneous lupus erythematosus 3.100 7.1e-05
interstitial cystitis 1.500 3.8e-03
lung adenocarcinoma -1.549 2.5e-08
lung carcinoma -1.300 1.9e-10
nephrosclerosis 1.478 3.3e-03
non-small cell lung cancer -1.725 8.4e-14
osteosarcoma -4.750 5.5e-05
psoriasis 1.200 2.0e-25
pulmonary arterial hypertension -1.300 2.1e-02
tuberculosis 1.100 1.4e-03

AA Sequence

MELCRSLALLGGSLGLMFCLIALSTDFWFEAVGPTHSAHSGLWPTGHGDIISGYIHVTQTFSIMAVLWAL      1 - 70
VSVSFLVLSCFPSLFPPGHGPLVSTTAAFAAAISMVVAMAVYTSERWDQPPHPQIQTFFSWSFYLGWVSA     71 - 140
ILLLCTGALSLGAHCGGPRPGYETL                                                 141 - 165
//

Text Mined References (6)

PMID Year Title