Property Summary

NCBI Gene PubMed Count 5
PubMed Score 9.72
PubTator Score 11.23

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (10)

Disease log2 FC p
nephrosclerosis 1.478 3.3e-03
cutaneous lupus erythematosus 3.100 7.1e-05
osteosarcoma -4.750 5.5e-05
tuberculosis 1.100 1.4e-03
non-small cell lung cancer -1.725 8.4e-14
interstitial cystitis 1.500 3.8e-03
lung adenocarcinoma -1.549 2.5e-08
pulmonary arterial hypertension -1.300 2.1e-02
lung carcinoma -1.300 1.9e-10
psoriasis 1.200 2.0e-25

Synonym

Accession Q16617
Symbols GIG1
GMP-17
p15-TIA-1

Gene

PANTHER Protein Class (1)

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG Inparanoid

AA Sequence

MELCRSLALLGGSLGLMFCLIALSTDFWFEAVGPTHSAHSGLWPTGHGDIISGYIHVTQTFSIMAVLWAL      1 - 70
VSVSFLVLSCFPSLFPPGHGPLVSTTAAFAAAISMVVAMAVYTSERWDQPPHPQIQTFFSWSFYLGWVSA     71 - 140
ILLLCTGALSLGAHCGGPRPGYETL                                                 141 - 165
//

Text Mined References (6)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
8570616 1996 Characterization of GMP-17, a granule membrane protein that moves to the plasma membrane of natural killer cells following target cell recognition.
8458737 1993 Characterization of a novel gene (NKG7) on human chromosome 19 that is expressed in natural killer cells and T cells.
7510105 1994 Molecular cloning and characterization of G-CSF induced gene cDNA.