Property Summary

NCBI Gene PubMed Count 22
PubMed Score 18.80
PubTator Score 15.61

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
lung adenocarcinoma 2714 6.3e-06
ovarian cancer 8491 2.3e-03
primary pancreatic ductal adenocarcinoma 1271 7.9e-03
fibroadenoma 557 1.9e-02
Disease Target Count Z-score Confidence
Hyperopia 33 3.053 1.5

Expression

  Differential Expression (4)

Disease log2 FC p
primary pancreatic ductal adenocarcinoma 1.026 7.9e-03
fibroadenoma 1.800 1.9e-02
lung adenocarcinoma -1.500 6.3e-06
ovarian cancer 1.300 2.3e-03

Gene RIF (7)

PMID Text
26902120 NKD2 regulates osteosarcoma cell proliferation and apoptosis by inhibiting the Wnt signaling.MiR-130b targets NKD2 and regulates the Wnt signaling to promote proliferation and inhibit apoptosis of osteosarcoma cells.
26396173 NKD2 methylation is associated with cell differentiation, TNM stage and distant metastasis significantly (all P < 0.05), and the overall survival time is longer in NKD2 unmethylated group compared to NKD2 methylated group (P < 0.05).
26124080 NKD2 is frequently methylated in human breast cancer, and the expression of NKD2 is regulated by promoter region methylation.
20177058 NKD2 antagonizes Wnt signaling: myristoylated NKD2 interacts with Dvl-1 at the plasma membrane, and this interaction leads to their mutual ubiquitin-mediated proteasomal degradation.
18757723 identify an EGFR-independent action of TGF-alpha, in which it protects Naked2 from proteasomal degradation, thus ensuring its delivery to the basolateral surface of polarized epithelial cells
17553928 Naked2 acts as a cargo recognition and targeting (CaRT) protein to ensure proper delivery, tethering, and fusion of TGF-alpha-containing vesicles to a distinct region at the basolateral surface of polarized epithelial cells.
16752383 NKD2 represents a candidate target of 5p amplifications in soft tissue sarcomas and might play a crucial role during the progression of this disease.

AA Sequence

MGKLQSKHAAAARKRRESPEGDSFVASAYASGRKGAEEAERRARDKQELPNGDPKEGPFREDQCPLQVAL      1 - 70
PAEKAEGREHPGQLLSADDGERAANREGPRGPGGQRLNIDALQCDVSVEEDDRQEWTFTLYDFDNCGKVT     71 - 140
REDMSSLMHTIYEVVDASVNHSSGSSKTLRVKLTVSPEPSSKRKEGPPAGQDREPTRCRMEGELAEEPRV    141 - 210
ADRRLSAHVRRPSTDPQPCSERGPYCVDENTERRNHYLDLAGIENYTSRFGPGSPPVQAKQEPQGRASHL    211 - 280
QARSRSQEPDTHAVHHRRSQVLVEHVVPASEPAARALDTQPRPKGPEKQFLKSPKGSGKPPGVPASSKSG    281 - 350
KAFSYYLPAVLPPQAPQDGHHLPQPPPPPYGHKRYRQKGREGHSPLKAPHAQPATVEHEVVRDLPPTPAG    351 - 420
EGYAVPVIQRHEHHHHHEHHHHHHHHHFHPS                                           421 - 451
//

Text Mined References (23)

PMID Year Title
26902120 2016 miR-130b targets NKD2 and regulates the Wnt signaling to promote proliferation and inhibit apoptosis in osteosarcoma cells.
26396173 2015 Silencing NKD2 by promoter region hypermethylation promotes gastric cancer invasion and metastasis by up-regulating SOX18 in human gastric cancer.
26124080 2015 Epigenetic silencing of NKD2, a major component of Wnt signaling, promotes breast cancer growth.
25086665 2014 Genome-wide association study identifies multiple susceptibility loci for pancreatic cancer.
24952745 2014 Genetic association study of QT interval highlights role for calcium signaling pathways in myocardial repolarization.
21988832 2011 Toward an understanding of the protein interaction network of the human liver.
20828404 2010 Convergence between Wnt-?-catenin and EGFR signaling in cancer.
20177058 2010 Myristoylated Naked2 antagonizes Wnt-beta-catenin activity by degrading Dishevelled-1 at the plasma membrane.
19847810 2010 Frequent promoter hypermethylation of Wnt pathway inhibitor genes in malignant astrocytic gliomas.
18757723 2008 EGF receptor-independent action of TGF-alpha protects Naked2 from AO7-mediated ubiquitylation and proteasomal degradation.
18504258 2008 Use of fluorescence-activated vesicle sorting for isolation of Naked2-associated, basolaterally targeted exocytic vesicles for proteomics analysis.
17764565 2007 Correlation between CpG methylation profiles and hormone receptor status in breast cancers.
17553928 2007 Naked2 acts as a cargo recognition and targeting protein to ensure proper delivery and fusion of TGF-alpha containing exocytic vesicles at the lower lateral membrane of polarized MDCK cells.
17362910 2007 Identification of oscillatory genes in somitogenesis from functional genomic analysis of a human mesenchymal stem cell model.
17045239 2006 Structural studies of human Naked2: a biologically active intrinsically unstructured protein.
16752383 2006 Frequent amplifications and abundant expression of TRIO, NKD2, and IRX2 in soft tissue sarcomas.
15687260 2005 PR72, a novel regulator of Wnt signaling required for Naked cuticle function.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15064403 2004 Myristoylated Naked2 escorts transforming growth factor alpha to the basolateral plasma membrane of polarized epithelial cells.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11604995 2001 Molecular cloning, gene structure, and expression analyses of NKD1 and NKD2.
11356022 2001 Vertebrate proteins related to Drosophila Naked Cuticle bind Dishevelled and antagonize Wnt signaling.
10737800 2000 Shotgun sequencing of the human transcriptome with ORF expressed sequence tags.