Property Summary

NCBI Gene PubMed Count 12
PubMed Score 35.80
PubTator Score 10.33

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count P-value
lung carcinoma 2844 2.2e-14
posterior fossa group B ependymoma 1530 7.3e-05
osteosarcoma 7933 2.6e-04
Disease Target Count Z-score Confidence
Crohn's disease 304 0.0 2.0
Disease Target Count Z-score Confidence
Chronic NK-cell lymphocytosis 6 3.684 1.8
Disease Target Count
Common variable immunodeficiency 98

Expression

  Differential Expression (3)

Disease log2 FC p
osteosarcoma 1.783 2.6e-04
posterior fossa group B ependymoma 1.200 7.3e-05
lung carcinoma -1.100 2.2e-14

Gene RIF (3)

PMID Text
26097589 Suggest that NKD1 plays an important role in invasion in human breast cancer and it appears to be a potential prognostic marker for patients with breast cancer.
21599923 Reduced NKD1 protein expression correlates with a poor prognosis in NSCLC
19956716 Mutations in the human naked cuticle homolog NKD1 found in colorectal cancer alter Wnt/Dvl/beta-catenin signaling

AA Sequence

MGKLHSKPAAVCKRRESPEGDSFAVSAAWARKGIEEWIGRQRCPGGVSGPRQLRLAGTIGRSTRELVGDV      1 - 70
LRDTLSEEEEDDFRLEVALPPEKTDGLGSGDEKKMERVSEPCPGSKKQLKFEELQCDVSMEEDSRQEWTF     71 - 140
TLYDFDNNGKVTREDITSLLHTIYEVVDSSVNHSPTSSKMLRVKLTVAPDGSQSKRSVLVNQADLQSARP    141 - 210
RAETKPTEDLRSWEKKQRAPLRFQGDSRLEQSGCYHHCVDENIERRNHYLDLAGIENYTSQFGPGSPSVA    211 - 280
QKSELPPRTSNPTRSRSHEPEAIHIPHRKPQGVDPASFHFLDTPIAKVSELQQRLRGTQDGSKHFVRSPK    281 - 350
AQGKSVGVGHVARGARNKPPLGPAIPAVSPSAHLAASPALLPSLAPLGHKKHKHRAKESQQGCRGLQAPL    351 - 420
ASGGPVLGREHLRELPALVVYESQAGQPVQRHEHHHHHEHHHHYHHFYQT                        421 - 470
//

Text Mined References (14)

PMID Year Title
26097589 2015 NKD1 down-regulation is associated with poor prognosis in breast invasive ductal carcinoma.
22412388 2012 A genome-wide scan of Ashkenazi Jewish Crohn's disease suggests novel susceptibility loci.
21599923 2011 Down-regulation of NKD1 increases the invasive potential of non-small-cell lung cancer and correlates with a poor prognosis.
19956716 2009 Mutations in the human naked cuticle homolog NKD1 found in colorectal cancer alter Wnt/Dvl/beta-catenin signaling.
16567647 2006 PR130 is a modulator of the Wnt-signaling cascade that counters repression of the antagonist Naked cuticle.
15687260 2005 PR72, a novel regulator of Wnt signaling required for Naked cuticle function.
15498874 2004 Large-scale cDNA transfection screening for genes related to cancer development and progression.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11752446 2001 Elevated expression of axin2 and hnkd mRNA provides evidence that Wnt/beta -catenin signaling is activated in human colon tumors.
11604995 2001 Molecular cloning, gene structure, and expression analyses of NKD1 and NKD2.
11356022 2001 Vertebrate proteins related to Drosophila Naked Cuticle bind Dishevelled and antagonize Wnt signaling.
11274398 2001 Cell autonomous regulation of multiple Dishevelled-dependent pathways by mammalian Nkd.