Property Summary

NCBI Gene PubMed Count 6
PubMed Score 1.55
PubTator Score 2.03

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Expression

  Differential Expression (7)

Disease log2 FC p
adrenocortical carcinoma -2.190 1.7e-06
Astrocytoma, Pilocytic -1.600 1.5e-09
Breast cancer 1.300 1.0e-05
breast carcinoma 2.300 8.5e-04
ependymoma -1.500 1.3e-15
group 3 medulloblastoma 1.200 2.3e-02
osteosarcoma 1.414 3.5e-05

Gene RIF (1)

AA Sequence

MGKCSGRCTLVAFCCLQLVAALERQIFDFLGYQWAPILANFLHIMAVILGIFGTVQYRSRYLILYAAWLV      1 - 70
LWVGWNAFIICFYLEVGQLSQDRDFIMTFNTSLHRSWWMENGPGCLVTPVLNSRLALEDHHVISVTGCLL     71 - 140
DYPYIEALSSALQIFLALFGFVFACYVSKVFLEEEDSFDFIGGFDSYGYQAPQKTSHLQLQPLYTSG       141 - 207
//

Text Mined References (6)

PMID Year Title