Property Summary

NCBI Gene PubMed Count 11
PubMed Score 58.33
PubTator Score 21.28

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Expression

  Differential Expression (9)

Disease log2 FC p
Multiple myeloma 1.780 1.2e-04
osteosarcoma -1.044 4.4e-02
glioblastoma 1.100 1.3e-02
lung cancer 1.500 2.1e-04
breast carcinoma 1.100 3.5e-03
group 3 medulloblastoma 1.100 2.4e-02
subependymal giant cell astrocytoma 1.410 3.6e-02
Pick disease -1.200 1.7e-04
ovarian cancer 1.700 2.3e-04

Synonym

Accession Q9NQR4 B2R9A3 D3DN47 Q8WUF0
Symbols HEL-S-8a

Gene

PANTHER Protein Class (1)

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (4)

PMID Text
25738796 Downregulation of NIT2 inhibits colon cancer cell proliferation and induces cell cycle arrest through the caspase-3 and PARP pathways
25008847 Human NIT1/2 are not involved in the metabolism of vildagliptin.
22674578 The activity and substrate specificity of human Nit2 was determined with alpha-ketoglutaramate and succinamate as substrates.
17488281 Genotype analysis in 4 types of tumor tissue showed allelic imbalance surrounding NIT2 locus; results show that NIT2 plays an important role in cell growth inhibition & links to malignancies, suggesting Nit2 may be a potential tumor suppressor candidate

AA Sequence

MTSFRLALIQLQISSIKSDNVTRACSFIREAATQGAKIVSLPECFNSPYGAKYFPEYAEKIPGESTQKLS      1 - 70
EVAKECSIYLIGGSIPEEDAGKLYNTCAVFGPDGTLLAKYRKIHLFDIDVPGKITFQESKTLSPGDSFST     71 - 140
FDTPYCRVGLGICYDMRFAELAQIYAQRGCQLLVYPGAFNLTTGPAHWELLQRSRAVDNQVYVATASPAR    141 - 210
DDKASYVAWGHSTVVNPWGEVLAKAGTEEAIVYSDIDLKKLAEIRQQIPVFRQKRSDLYAVEMKKP        211 - 276
//

Text Mined References (19)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25738796 2015 Downregulation of NIT2 inhibits colon cancer cell proliferation and induces cell cycle arrest through the caspase-3 and PARP pathways.
25008847 2014 Human nitrilase-like protein does not catalyze the hydrolysis of vildagliptin.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
22674578 2012 Structural insights into the catalytic active site and activity of human Nit2/?-amidase: kinetic assay and molecular dynamics simulation.
21269460 2011 Initial characterization of the human central proteome.
19595734 2009 Identification of the putative tumor suppressor Nit2 as omega-amidase, an enzyme metabolically linked to glutamine and asparagine transamination.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17488281 2007 Growth inhibitory effect of the human NIT2 gene and its allelic imbalance in cancers.
16341674 2005 Transcriptome analysis of human gastric cancer.
15592455 2005 Immunoaffinity profiling of tyrosine phosphorylation in cancer cells.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14528910 2003 Deranged hypothetical proteins Rik protein, Nit protein 2 and mitochondrial inner membrane protein, Mitofilin, in fetal Down syndrome brain.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10959838 2000 Crystal structure of the worm NitFhit Rosetta Stone protein reveals a Nit tetramer binding two Fhit dimers.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.