Property Summary

NCBI Gene PubMed Count 12
PubMed Score 159.20
PubTator Score 14.73

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
group 3 medulloblastoma 1.200 2.0e-02
osteosarcoma -1.835 3.0e-05
ovarian cancer 1.200 2.1e-07
tuberculosis and treatment for 6 months -1.100 6.3e-03

Gene RIF (5)

AA Sequence

MLGFITRPPHRFLSLLCPGLRIPQLSVLCAQPRPRAMAISSSSCELPLVAVCQVTSTPDKQQNFKTCAEL      1 - 70
VREAARLGACLAFLPEAFDFIARDPAETLHLSEPLGGKLLEEYTQLARECGLWLSLGGFHERGQDWEQTQ     71 - 140
KIYNCHVLLNSKGAVVATYRKTHLCDVEIPGQGPMCESNSTMPGPSLESPVSTPAGKIGLAVCYDMRFPE    141 - 210
LSLALAQAGAEILTYPSAFGSITGPAHWEVLLRARAIETQCYVVAAAQCGRHHEKRASYGHSMVVDPWGT    211 - 280
VVARCSEGPGLCLARIDLNYLRQLRRHLPVFQHRRPDLYGNLGHPLS                           281 - 327
//

Text Mined References (15)

PMID Year Title