Property Summary

NCBI Gene PubMed Count 13
PubMed Score 2.06
PubTator Score 1.71

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
aldosterone-producing adenoma -1.043 4.7e-02
Amyotrophic lateral sclerosis 1.074 7.8e-04
astrocytic glioma -1.900 1.5e-02
Duchenne muscular dystrophy 1.637 4.1e-05
juvenile dermatomyositis 1.781 2.6e-09
non-small cell lung cancer -1.138 3.6e-18
oligodendroglioma -2.000 4.3e-02
ovarian cancer -1.200 1.0e-02
tuberculosis 1.300 4.5e-06
ulcerative colitis -1.200 6.4e-06

Synonym

Accession Q9UFN0 A6NM55 Q5VX32 Q9BRV7 Q9H843 Q9P083 NipSnap3A
Symbols TASSC
HSPC299
NIPSNAP4

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (1)

AA Sequence

MLVLRSALTRALASRTLAPQMCSSFATGPRQYDGIFYEFRSYYLKPSKMNEFLENFEKNAHLRTAHSELV      1 - 70
GYWSVEFGGRMNTVFHIWKYDNFAHRTEVRKALAKDKEWQEQFLIPNLALIDKQESEITYLVPWCKLEKP     71 - 140
PKEGVYELATFQMKPGGPALWGDAFKRAVHAHVNLGYTKLVGVFHTEYGALNRVHVLWWNESADSRAAGR    141 - 210
HKSHEDPRVVAAVRESVNYLVSQQNMLLIPTSFSPLK                                     211 - 247
//

Text Mined References (19)

PMID Year Title