Property Summary

NCBI Gene PubMed Count 14
PubMed Score 7.77
PubTator Score 4.63

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
ependymoma -1.100 1.0e-02
pancreatic ductal adenocarcinoma liver m... -1.235 2.2e-02
non-small cell lung cancer 1.488 2.9e-21
lung cancer 2.800 7.5e-05
adult high grade glioma -1.100 2.9e-03
lung carcinoma 1.100 1.9e-24

Synonym

Accession Q9BPW8 B2RAY3 O43800 NipSnap1
Symbols

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (5)

PMID Text
24137763 NIPSNAP1 mutations could not explain phenotype of patients with combined oxidative phosphorylation system deficiencies.
23792589 Structural variants unique to the malignant cell line inactivated: gene NIPSNAP1, putative tumor suppressor that inhibits TRPV6, an anti-apoptotic oncogene implicated in prostate cancer progression.
22311985 NIPSNAP1 is an interacting molecule of NST and plays a crucial role in pain transmission.
20877624 Observational study of gene-disease association. (HuGE Navigator)
18392847 This study presents the first physiological function of mouse Nipsnap1 as an associated protein inhibiting transient receptor potential vanilloid channel 6 activity that possibly exerts its effect directly at the plasma membrane.

AA Sequence

MAPRLCSISVTARRLLGGPGPRAGDVASAAAARFYSKDNEGSWFRSLFVHKVDPRKDAHSTLLSKKETSN      1 - 70
LYKIQFHNVKPEYLDAYNSLTEAVLPKLHLDEDYPCSLVGNWNTWYGEQDQAVHLWRFSGGYPALMDCMN     71 - 140
KLKNNKEYLEFRRERSQMLLSRRNQLLLEFSFWNEPQPRMGPNIYELRTYKLKPGTMIEWGNNWARAIKY    141 - 210
RQENQEAVGGFFSQIGELYVVHHLWAYKDLQSREETRNAAWRKRGWDENVYYTVPLVRHMESRIMIPLKI    211 - 280
SPLQ                                                                      281 - 284
//

Text Mined References (19)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25126726 2014 FLCN, a novel autophagy component, interacts with GABARAP and is regulated by ULK1 phosphorylation.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24137763 2010 Sequence variants in four candidate genes (NIPSNAP1, GBAS, CHCHD1 and METT11D1) in patients with combined oxidative phosphorylation system deficiencies.
23792589 2013 Chromosomal structural variations during progression of a prostate epithelial cell line to a malignant metastatic state inactivate the NF2, NIPSNAP1, UGT2B17, and LPIN2 genes.
22311985 2012 Identification of NIPSNAP1 as a nocistatin-interacting protein involving pain transmission.
21269460 2011 Initial characterization of the human central proteome.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
20562859 2010 Network organization of the human autophagy system.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
18392847 2008 Identification of Nipsnap1 as a novel auxiliary protein inhibiting TRPV6 activity.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12925885 2003 Strong conservation of the human NF2 locus based on sequence comparison in five species.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11895482 2002 Identification of activity-regulated proteins in the postsynaptic density fraction.
9661659 1998 Characterization of the human NIPSNAP1 gene from 22q12: a member of a novel gene family.