Property Summary

NCBI Gene PubMed Count 17
PubMed Score 7.47
PubTator Score 4.63

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
adult high grade glioma -1.100 2.9e-03
ependymoma -1.100 1.0e-02
lung cancer 2.800 7.5e-05
lung carcinoma 1.100 1.9e-24
non-small cell lung cancer 1.488 2.9e-21
pancreatic ductal adenocarcinoma liver m... -1.235 2.2e-02

Gene RIF (8)

AA Sequence

MAPRLCSISVTARRLLGGPGPRAGDVASAAAARFYSKDNEGSWFRSLFVHKVDPRKDAHSTLLSKKETSN      1 - 70
LYKIQFHNVKPEYLDAYNSLTEAVLPKLHLDEDYPCSLVGNWNTWYGEQDQAVHLWRFSGGYPALMDCMN     71 - 140
KLKNNKEYLEFRRERSQMLLSRRNQLLLEFSFWNEPQPRMGPNIYELRTYKLKPGTMIEWGNNWARAIKY    141 - 210
RQENQEAVGGFFSQIGELYVVHHLWAYKDLQSREETRNAAWRKRGWDENVYYTVPLVRHMESRIMIPLKI    211 - 280
SPLQ                                                                      281 - 284
//

Text Mined References (22)

PMID Year Title