Property Summary

NCBI Gene PubMed Count 8
PubMed Score 2.00
PubTator Score 1.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Disease log2 FC p
malignant mesothelioma -2.700 5.3e-06
astrocytic glioma -2.100 1.4e-03
oligodendroglioma -1.900 1.5e-02
glioblastoma -1.700 6.6e-03
osteosarcoma -1.764 3.4e-03
sonic hedgehog group medulloblastoma -1.700 6.1e-05
atypical teratoid / rhabdoid tumor -2.200 4.4e-07
medulloblastoma, large-cell -1.900 2.8e-03
primitive neuroectodermal tumor -2.100 1.1e-03
tuberculosis 2.200 1.3e-08
intraductal papillary-mucinous adenoma (... 1.200 5.5e-03
lung cancer -2.000 1.9e-04
adult high grade glioma -1.500 2.5e-03
posterior fossa group A ependymoma -1.100 2.8e-05
Alzheimer's disease -1.200 2.5e-02
Pick disease -2.000 2.4e-05
ovarian cancer -2.000 8.6e-07
pituitary cancer -1.600 2.1e-04

AA Sequence

MAAVAPAGPGDSASAALDELSLNFTYGAPGAGNGSLSGDWYRRNQIHLFGVLLAILGNLVISISLNIQKY      1 - 70
SHLQLAQQEHPRPYFKSVLWWGGVLLMAVGETGNFAAYGFAPITLIAPLGCVSVTGSAIISVTFLKDNLR     71 - 140
ASDLLGTTLAFAGTYLLVNFAPNITQAISARTVQYYLVGWQFLIYVILEILIFCILLYFYKRKGMKHMVI    141 - 210
LLTLVAILASLTVISVKAVSGMITFSVMDKMQLTYPIFYIMFIIMIASCVFQVKFLNQATKLYNTTTVVP    211 - 280
VNHIFFTISAIIAGIIFYQEFLGAPFLTVFIYLFGCFLSFLGVFLVTRNREKEHLQQSYIDFGNIPDTTP    281 - 350
ERKAWRETNVGQNTTRFT                                                        351 - 368
//

Text Mined References (10)

PMID Year Title
23400010 2014 Genome-wide association analyses suggest NELL1 influences adverse metabolic response to HCTZ in African Americans.
16421571 2006 DNA sequence and analysis of human chromosome 8.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
15317751 2004 Mutations in ichthyin a new gene on chromosome 5q33 in a new form of autosomal recessive congenital ichthyosis.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11827452 2002 Gene expression profile of human bone marrow stromal cells: high-throughput expressed sequence tag sequencing analysis.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.