Property Summary

NCBI Gene PubMed Count 13
PubMed Score 7.99
PubTator Score 10.67

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
Breast cancer 2.600 2.9e-02
intraductal papillary-mucinous neoplasm ... 1.500 2.8e-03
Multiple myeloma 1.744 3.3e-05
ovarian cancer 1.800 5.0e-05

Gene RIF (5)

AA Sequence

MSQGRGKYDFYIGLGLAMSSSIFIGGSFILKKKGLLRLARKGSMRAGQGGHAYLKEWLWWAGLLSMGAGE      1 - 70
VANFAAYAFAPATLVTPLGALSVLVSAILSSYFLNERLNLHGKIGCLLSILGSTVMVIHAPKEEEIETLN     71 - 140
EMSHKLGDPGFVVFATLVVIVALILIFVVGPRHGQTNILVYITICSVIGAFSVSCVKGLGIAIKELFAGK    141 - 210
PVLRHPLAWILLLSLIVCVSTQINYLNRALDIFNTSIVTPIYYVFFTTSVLTCSAILFKEWQDMPVDDVI    211 - 280
GTLSGFFTIIVGIFLLHAFKDVSFSLASLPVSFRKDEKAMNGNLSNMYEVLNNNEESLTCGIEQHTGENV    281 - 350
SRRNGNLTAF                                                                351 - 360
//

Text Mined References (14)

PMID Year Title