Property Summary

NCBI Gene PubMed Count 18
PubMed Score 12.68
PubTator Score 8.54

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (6)

Disease log2 FC p
glioblastoma 1.100 1.1e-05
medulloblastoma, large-cell 1.400 6.2e-05
lung cancer 1.100 4.1e-03
pediatric high grade glioma 1.200 3.8e-05
sonic hedgehog group medulloblastoma 1.100 6.4e-05
ovarian cancer 1.600 9.6e-04

 GO Function (1)

Gene RIF (5)

PMID Text
23166591 Expression of HIV-1 Tat upregulates the abundance of nuclear import 7 homolog (NIP7) in the nucleoli of Jurkat T-cells
22195017 The results presented in this work indicate a close functional interaction between NIP7 and FTSJ3 during pre-rRNA processing and show that FTSJ3 participates in ribosome synthesis in human cells.
20798176 Downregulation of NIP7 affects pre-rRNA processing, causing an imbalance of the 40S/60S subunit ratio.
17643419 SBDS is found in complexes containing the human Nip7 ortholog.
15522784 KD93 is a novel protein expressed in human hematopoietic stem/progenitor cells

AA Sequence

MRPLTEEETRVMFEKIAKYIGENLQLLVDRPDGTYCFRLHNDRVYYVSEKIMKLAANISGDKLVSLGTCF      1 - 70
GKFTKTHKFRLHVTALDYLAPYAKYKVWIKPGAEQSFLYGNHVLKSGLGRITENTSQYQGVVVYSMADIP     71 - 140
LGFGVAAKSTQDCRKVDPMAIVVFHQADIGEYVRHEETLT                                  141 - 180
//

Text Mined References (20)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
22195017 2011 The human nucleolar protein FTSJ3 associates with NIP7 and functions in pre-rRNA processing.
21269460 2011 Initial characterization of the human central proteome.
20798176 2011 The NIP7 protein is required for accurate pre-rRNA processing in human cells.
17643419 2007 The Shwachman-Bodian-Diamond syndrome associated protein interacts with HsNip7 and its down-regulation affects gene expression at the transcriptional and translational levels.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
16341674 2005 Transcriptome analysis of human gastric cancer.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15635413 2005 Nucleolar proteome dynamics.
15522784 2004 Crystal structure of KD93, a novel protein expressed in human hematopoietic stem/progenitor cells.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14660641 2004 A novel human nucleolar protein, Nop132, binds to the G proteins, RRAG A/C/D.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12429849 2002 Functional proteomic analysis of human nucleolus.
12417987 2002 A missense mutation (R565W) in cirhin (FLJ14728) in North American Indian childhood cirrhosis.
11042152 2000 Cloning and functional analysis of cDNAs with open reading frames for 300 previously undefined genes expressed in CD34+ hematopoietic stem/progenitor cells.
10810093 2000 Identification of novel human genes evolutionarily conserved in Caenorhabditis elegans by comparative proteomics.