Property Summary

NCBI Gene PubMed Count 18
PubMed Score 12.68
PubTator Score 8.54

Knowledge Summary


No data available


  Disease (2)


  Differential Expression (6)

Disease log2 FC p
glioblastoma 1.100 1.1e-05
lung cancer 1.100 4.1e-03
medulloblastoma, large-cell 1.400 6.2e-05
ovarian cancer 1.600 9.6e-04
pediatric high grade glioma 1.200 3.8e-05
sonic hedgehog group medulloblastoma 1.100 6.4e-05


Accession Q9Y221 B2RD04 Q9NZZ0
Symbols KD93



1SQW   1T5Y  

  Ortholog (1)

Species Source Disease
Chimp OMA Inparanoid

 GO Function (1)

Gene RIF (5)

AA Sequence

LGFGVAAKSTQDCRKVDPMAIVVFHQADIGEYVRHEETLT                                  141 - 180

Text Mined References (20)

PMID Year Title