Property Summary

NCBI Gene PubMed Count 18
PubMed Score 12.68
PubTator Score 8.54

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (6)

Disease log2 FC p
glioblastoma 1.100 1.1e-05
lung cancer 1.100 4.1e-03
medulloblastoma, large-cell 1.400 6.2e-05
ovarian cancer 1.600 9.6e-04
pediatric high grade glioma 1.200 3.8e-05
sonic hedgehog group medulloblastoma 1.100 6.4e-05

 GO Function (1)

Gene RIF (5)

AA Sequence

MRPLTEEETRVMFEKIAKYIGENLQLLVDRPDGTYCFRLHNDRVYYVSEKIMKLAANISGDKLVSLGTCF      1 - 70
GKFTKTHKFRLHVTALDYLAPYAKYKVWIKPGAEQSFLYGNHVLKSGLGRITENTSQYQGVVVYSMADIP     71 - 140
LGFGVAAKSTQDCRKVDPMAIVVFHQADIGEYVRHEETLT                                  141 - 180
//

Text Mined References (20)

PMID Year Title