Property Summary

NCBI Gene PubMed Count 24
PubMed Score 57.92
PubTator Score 27.19

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (7)

Disease log2 FC p
astrocytoma 1.200 3.2e-03
gastric cancer -1.100 1.8e-03
glioblastoma 1.300 4.0e-03
medulloblastoma, large-cell -1.200 1.7e-03
mucosa-associated lymphoid tissue lympho... 1.402 4.4e-02
subependymal giant cell astrocytoma 1.945 2.3e-02
tuberculosis -1.300 2.2e-03

Gene RIF (15)

AA Sequence

MDSGTEEYELNGGLPPGTPGSPDASPARWGWRHGPINVNHYASKKSAAESMLDIALLMANASQLKAVVEQ      1 - 70
GPSFAFYVPLVVLISISLVLQIGVGVLLIFLVKYDLNNPAKHAKLDFLNNLATGLVFIIVVVNIFITAFG     71 - 140
VQKPLMDMAPQQ                                                              141 - 152
//

Text Mined References (25)

PMID Year Title