Property Summary

NCBI Gene PubMed Count 4
PubMed Score 21.21
PubTator Score 5.83

Knowledge Summary

Patent (8,450)

Expression

  Differential Expression (6)

Disease log2 FC p
sonic hedgehog group medulloblastoma -2.700 6.7e-07
atypical teratoid / rhabdoid tumor -2.600 1.7e-04
glioblastoma -1.300 2.5e-02
medulloblastoma, large-cell -2.300 5.3e-04
primitive neuroectodermal tumor -1.500 1.7e-03
adrenocortical carcinoma 1.094 2.5e-02

AA Sequence

MTAVYMNGGGLVNPHYARWDRRDSVESGCQTESSKEGEEGQPRQLTPFEKLTQDMSQDEKVVREITLGKR      1 - 70
IGFYRIRGEIGSGNFSQVKLGIHSLTKEKVAIKILDKTKLDQKTQRLLSREISSMEKLHHPNIIRLYEVV     71 - 140
ETLSKLHLVMEYAGGGELFGKISTEGKLSEPESKLIFSQIVSAVKHMHENQIIHRDLKAENVFYTSNTCV    141 - 210
KVGDFGFSTVSKKGEMLNTFCGSPPYAAPELFRDEHYIGIYVDIWALGVLLYFMVTGTMPFRAETVAKLK    211 - 280
KSILEGTYSVPPHVSEPCHRLIRGVLQQIPTERYGIDCIMNDEWMQGVPYPTPLEPFQLDPKHLSETSTL    281 - 350
KEEENEVKSTLEHLGITEEHIRNNQGRDARSSITGVYRIILHRVQRKKALESVPVMMLPDPKERDLKKGS    351 - 420
RVYRGIRHTSKFCSIL                                                          421 - 436
//

Text Mined References (6)

PMID Year Title
17344846 2007 Patterns of somatic mutation in human cancer genomes.
15733851 2005 Identification of the sucrose non-fermenting related kinase SNRK, as a novel LKB1 substrate.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15372022 2004 The DNA sequence and comparative analysis of human chromosome 5.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.