Property Summary

NCBI Gene PubMed Count 50
PubMed Score 611.81
PubTator Score 144.29

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count P-value
astrocytoma 1493 3.5e-21
oligodendroglioma 2849 1.0e-12
juvenile dermatomyositis 1189 1.4e-11
posterior fossa group A ependymoma 1511 2.4e-11
nasopharyngeal carcinoma 1056 2.4e-08
glioblastoma 5572 8.7e-08
pediatric high grade glioma 2712 1.3e-07
Duchenne muscular dystrophy 602 7.5e-07
sonic hedgehog group medulloblastoma 1482 1.6e-06
Breast cancer 3098 2.4e-06
pilocytic astrocytoma 3086 6.0e-06
ulcerative colitis 2087 1.2e-05
primitive neuroectodermal tumor 3031 3.0e-05
interstitial cystitis 2299 3.6e-05
tuberculosis and treatment for 3 months 327 1.3e-04
atypical teratoid / rhabdoid tumor 4369 2.2e-04
medulloblastoma, large-cell 6234 3.1e-04
acute quadriplegic myopathy 1157 1.0e-03
pituitary cancer 1972 2.6e-03
invasive ductal carcinoma 2950 2.7e-03
autosomal dominant Emery-Dreifuss muscular dystrophy 499 3.8e-03
mucosa-associated lymphoid tissue lymphoma 480 8.1e-03
nephrosclerosis 329 9.1e-03
intraductal papillary-mucinous adenoma (IPMA) 2956 1.1e-02
adrenocortical adenoma 134 1.1e-02
Becker muscular dystrophy 187 1.2e-02
adrenocortical carcinoma 1427 1.2e-02
diabetes mellitus 1663 1.9e-02
intraductal papillary-mucinous neoplasm (IPMN) 3289 1.9e-02
Polycystic Ovary Syndrome 334 2.1e-02
dermatomyositis 966 2.4e-02
pancreatic ductal adenocarcinoma liver metastasis 1795 2.6e-02
psoriasis 6685 2.9e-02
osteosarcoma 7933 3.3e-02
intraductal papillary-mucinous carcinoma (IPMC) 2988 3.6e-02
Pick disease 1893 3.8e-02
aldosterone-producing adenoma 664 4.8e-02
Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0
Disease Target Count Z-score Confidence
Disease of cellular proliferation 3 0.0 2.0

Expression

  Differential Expression (37)

Disease log2 FC p
nephrosclerosis 1.047 9.1e-03
oligodendroglioma 2.200 1.0e-12
psoriasis 1.300 2.9e-02
astrocytoma 2.100 3.5e-21
glioblastoma 3.300 8.7e-08
osteosarcoma 1.579 3.3e-02
posterior fossa group A ependymoma 2.000 2.4e-11
sonic hedgehog group medulloblastoma 3.200 1.6e-06
atypical teratoid / rhabdoid tumor 2.100 2.2e-04
medulloblastoma, large-cell 1.700 3.1e-04
primitive neuroectodermal tumor 2.300 3.0e-05
Duchenne muscular dystrophy 1.594 7.5e-07
autosomal dominant Emery-Dreifuss muscul... 1.611 3.8e-03
Becker muscular dystrophy 1.137 1.2e-02
juvenile dermatomyositis 1.917 1.4e-11
acute quadriplegic myopathy 1.210 1.0e-03
adrenocortical adenoma -1.147 1.1e-02
adrenocortical carcinoma -1.041 1.2e-02
tuberculosis and treatment for 3 months 1.800 1.3e-04
pancreatic ductal adenocarcinoma liver m... -1.306 2.6e-02
intraductal papillary-mucinous adenoma (... -2.200 1.1e-02
intraductal papillary-mucinous carcinoma... -1.900 3.6e-02
intraductal papillary-mucinous neoplasm ... -2.800 1.9e-02
diabetes mellitus -1.300 1.9e-02
interstitial cystitis 1.500 3.6e-05
pediatric high grade glioma 2.700 1.3e-07
pilocytic astrocytoma 1.900 6.0e-06
aldosterone-producing adenoma -1.235 4.8e-02
nasopharyngeal carcinoma 2.200 2.4e-08
Polycystic Ovary Syndrome -1.247 2.1e-02
Pick disease 1.300 3.8e-02
Breast cancer 1.900 2.4e-06
mucosa-associated lymphoid tissue lympho... 1.993 8.1e-03
invasive ductal carcinoma -1.400 2.7e-03
ulcerative colitis 2.900 1.2e-05
pituitary cancer -1.200 2.6e-03
dermatomyositis 1.200 2.4e-02

Protein-protein Interaction (1)

Gene RIF (9)

PMID Text
25924802 Increase of NID1 protein expression is associated with endometrial cancer invasion.
25857602 NID1 was confirmed as a target gene of MiR-192/215 in Hirschsprung's disease patients.
23681936 The cleavage of nidogen-1 and -2 is partially inhibited in human tumor samples.
23674478 results demonstrate that mutation in either NID1 or LAMC1 disrupts the interaction NID1-LAMC1 complex; findings implicate the extracellular matrix in the pathogenesis of Dandy-Walker spectrum disorders
22952693 Cleavage of nidogen-1 by cathepsin S impairs its binding to basement membrane partners
21478494 NID1 gene is a biologically plausible locus for nevogenesis and melanoma development
17328794 CpG islands of both NID1 and NID2 genes are aberrantly methylated in human cancer samples and cancer cell lines.
17008882 nidogen-2 is equivalent to nidogen-1 in skin-organotypic coculture, and both can promote the development of a functional basement membrane zone
12005023 found to be ubiquitous component of basement membrane zones underneath developing epithelia of most of the major organ systems; may participate in cell biological functions during human development

AA Sequence

MLASSSRIRAAWTRALLLPLLLAGPVGCLSRQELFPFGPGQGDLELEDGDDFVSPALELSGALRFYDRSD      1 - 70
IDAVYVTTNGIIATSEPPAKESHPGLFPPTFGAVAPFLADLDTTDGLGKVYYREDLSPSITQRAAECVHR     71 - 140
GFPEISFQPSSAVVVTWESVAPYQGPSRDPDQKGKRNTFQAVLASSDSSSYAIFLYPEDGLQFHTTFSKK    141 - 210
ENNQVPAVVAFSQGSVGFLWKSNGAYNIFANDRESVENLAKSSNSGQQGVWVFEIGSPATTNGVVPADVI    211 - 280
LGTEDGAEYDDEDEDYDLATTRLGLEDVGTTPFSYKALRRGGADTYSVPSVLSPRRAATERPLGPPTERT    281 - 350
RSFQLAVETFHQQHPQVIDVDEVEETGVVFSYNTDSRQTCANNRHQCSVHAECRDYATGFCCSCVAGYTG    351 - 420
NGRQCVAEGSPQRVNGKVKGRIFVGSSQVPIVFENTDLHSYVVMNHGRSYTAISTIPETVGYSLLPLAPV    421 - 490
GGIIGWMFAVEQDGFKNGFSITGGEFTRQAEVTFVGHPGNLVIKQRFSGIDEHGHLTIDTELEGRVPQIP    491 - 560
FGSSVHIEPYTELYHYSTSVITSSSTREYTVTEPERDGASPSRIYTYQWRQTITFQECVHDDSRPALPST    561 - 630
QQLSVDSVFVLYNQEEKILRYALSNSIGPVREGSPDALQNPCYIGTHGCDTNAACRPGPRTQFTCECSIG    631 - 700
FRGDGRTCYDIDECSEQPSVCGSHTICNNHPGTFRCECVEGYQFSDEGTCVAVVDQRPINYCETGLHNCD    701 - 770
IPQRAQCIYTGGSSYTCSCLPGFSGDGQACQDVDECQPSRCHPDAFCYNTPGSFTCQCKPGYQGDGFRCV    771 - 840
PGEVEKTRCQHEREHILGAAGATDPQRPIPPGLFVPECDAHGHYAPTQCHGSTGYCWCVDRDGREVEGTR    841 - 910
TRPGMTPPCLSTVAPPIHQGPAVPTAVIPLPPGTHLLFAQTGKIERLPLEGNTMRKTEAKAFLHVPAKVI    911 - 980
IGLAFDCVDKMVYWTDITEPSIGRASLHGGEPTTIIRQDLGSPEGIAVDHLGRNIFWTDSNLDRIEVAKL    981 - 1050
DGTQRRVLFETDLVNPRGIVTDSVRGNLYWTDWNRDNPKIETSYMDGTNRRILVQDDLGLPNGLTFDAFS   1051 - 1120
SQLCWVDAGTNRAECLNPSQPSRRKALEGLQYPFAVTSYGKNLYFTDWKMNSVVALDLAISKETDAFQPH   1121 - 1190
KQTRLYGITTALSQCPQGHNYCSVNNGGCTHLCLATPGSRTCRCPDNTLGVDCIEQK                1191 - 1247
//

Text Mined References (53)

PMID Year Title
25924802 2015 Nidogen 1 and Nuclear Protein 1: novel targets of ETV5 transcription factor involved in endometrial cancer invasion.
25857602 2015 Nidogen-1 is a common target of microRNAs MiR-192/215 in the pathogenesis of Hirschsprung's disease.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23681936 2013 Contribution of ADAMTS1 as a tumor suppressor gene in human breast carcinoma. Linking its tumor inhibitory properties to its proteolytic activity on nidogen-1 and nidogen-2.
23674478 2013 Mutations in extracellular matrix genes NID1 and LAMC1 cause autosomal dominant Dandy-Walker malformation and occipital cephaloceles.
23658023 2013 Comparative proteomic analysis of supportive and unsupportive extracellular matrix substrates for human embryonic stem cell maintenance.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
22952693 2012 Cleavage of nidogen-1 by cathepsin S impairs its binding to basement membrane partners.
22261194 2012 Proteomics analysis of cardiac extracellular matrix remodeling in a porcine model of ischemia/reperfusion injury.
21478494 2011 Genome-wide association study identifies nidogen 1 (NID1) as a susceptibility locus to cutaneous nevi and melanoma risk.
20551380 2010 Proteomics characterization of extracellular space components in the human aorta.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
17328794 2007 Nidogen 1 and 2 gene promoters are aberrantly methylated in human gastrointestinal cancer.
17008882 2007 Lack of nidogen-1 and -2 prevents basement membrane assembly in skin-organotypic coculture.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16574105 2006 Identification of the basement membrane protein nidogen as a candidate ligand for tumor endothelial marker 7 in vitro and in vivo.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15231748 2004 Functional proteomics mapping of a human signaling pathway.
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
12931195 2003 Complex between nidogen and laminin fragments reveals a paradigmatic beta-propeller interface.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12180907 2002 Matrilin-2 interacts with itself and with other extracellular matrix proteins.
12005023 Nidogen-1 and nidogen-2 are found in basement membranes during human embryonic development.
11956183 2002 The type XIII collagen ectodomain is a 150-nm rod and capable of binding to fibronectin, nidogen-2, perlecan, and heparin.
11847210 2002 The leucine-rich repeat protein PRELP binds perlecan and collagens and may function as a basement membrane anchor.
11733994 2001 Short arm region of laminin-5 gamma2 chain: structure, mechanism of processing and binding to heparin and proteins.
11574465 2001 Structural basis for the high-affinity interaction of nidogen-1 with immunoglobulin-like domain 3 of perlecan.
11493006 2001 Mapping of binding sites for nidogens, fibulin-2, fibronectin and heparin to different IG modules of perlecan.
11419941 2001 cDNA and genomic cloning of lacritin, a novel secretion enhancing factor from the human lacrimal gland.
11376898 2001 Entactin-induced inhibition of human amyloid beta-protein fibril formation in vitro.
9733643 1998 Nidogen-2: a new basement membrane protein with diverse binding properties.
9686320 1998 Adhesion of cultured human kidney mesangial cells to native entactin: role of integrin receptors.
9647658 1998 The laminin-nidogen complex is a ligand for a specific splice isoform of the transmembrane protein tyrosine phosphatase LAR.
9501082 1998 Mac-2 binding protein is a cell-adhesive protein of the extracellular matrix which self-assembles into ring-like structures and binds beta1 integrins, collagens and fibronectin.
9299350 1997 Binding of fibulin-1 to nidogen depends on its C-terminal globular domain and a specific array of calcium-binding epidermal growth factor-like (EG) modules.
9278415 1997 The self-association and fibronectin-binding sites of fibulin-1 map to calcium-binding epidermal growth factor-like domains.
8995276 1997 Characterization of high affinity binding between laminin and the acute-phase protein, serum amyloid A.
8831898 1996 Human trophoblast cell adhesion to extracellular matrix protein, entactin.
8354280 1993 Sequence of extracellular mouse protein BM-90/fibulin and its calcium-dependent binding to other basement-membrane ligands.
7867626 1995 Binding properties and protease stability of recombinant human nidogen.
7557988 1995 Genomic sequences and structural organization of the human nidogen gene (NID).
7500359 1995 Binding of mouse and human fibulin-2 to extracellular matrix ligands.
2574658 1989 Human nidogen: complete amino acid sequence and structural domains deduced from cDNAs, and evidence for polymorphism of the gene.
2506015 1989 Binding of nidogen and the laminin-nidogen complex to basement membrane collagen type IV.
2471408 1989 Human nidogen: cDNA cloning, cellular expression, and mapping of the gene to chromosome Iq43.
2180767 1990 Molecular architecture of basement membranes.
2119632 1990 Entactin: structure and function.
1906509 1991 Human nidogen gene: structural and functional characterization of the 5'-flanking region.
1680863 1991 Potential role of entactin in hemostasis. Specific interaction of entactin with fibrinogen A alpha and B beta chains.
1499567 1992 Urokinase binding to laminin-nidogen. Structural requirements and interactions with heparin.