Property Summary

NCBI Gene PubMed Count 27
PubMed Score 27.81
PubTator Score 19.62

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
Multiple myeloma 1.972 3.1e-04
psoriasis 1.700 4.3e-05
lung cancer 2.300 1.1e-03
non primary Sjogren syndrome sicca 1.100 4.7e-02
ovarian cancer 2.200 4.5e-05

Gene RIF (6)

PMID Text
25906515 Indian aplastic anemia patients did not have NHP2 mutations.
22944692 Positional proteomics analysis identifies the cleavage of human NHP2 ribonucleoprotein homolog (yeast) (NHP2) at amino acid residues 27-28 by the HIV-1 protease
20008900 Effects of dyskeratosis congenita mutations in NHP2 on assembly of H/ACA pre-RNPs
18523010 The analysis of two other proteins, NHP2 and GAR1, that together with dyskerin and NOP10 are key components of telomerase and small nucleolar ribonucleoprotein (snoRNP) complexes, is described.
15889794 NOLA2 expression in patients with squamous cell lung cancer increased by 70% which makes it a highly informative marker of squamous cell lung cancer
15814878 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MTKIKADPDGPEAQAEACSGERTYQELLVNQNPIAQPLASRRLTRKLYKCIKKAVKQKQIRRGVKEVQKF      1 - 70
VNKGEKGIMVLAGDTLPIEVYCHLPVMCEDRNLPYVYIPSKTDLGAAAGSKRPTCVIMVKPHEEYQEAYD     71 - 140
ECLEEVQSLPLPL                                                             141 - 153
//

Text Mined References (37)

PMID Year Title
25906515 2014 Detection of mutations in TERT, the genes for telomerase reverse transcriptase, in Indian patients of aplastic anaemia: a pilot study.
25772364 2015 SUMO-2 Orchestrates Chromatin Modifiers in Response to DNA Damage.
25755297 2015 System-wide Analysis of SUMOylation Dynamics in Response to Replication Stress Reveals Novel Small Ubiquitin-like Modified Target Proteins and Acceptor Lysines Relevant for Genome Stability.
25467444 2014 Proteostatic control of telomerase function through TRiC-mediated folding of TCAB1.
25416956 2014 A proteome-scale map of the human interactome network.
25218447 2014 Uncovering global SUMOylation signaling networks in a site-specific manner.
25114211 2014 Mapping of SUMO sites and analysis of SUMOylation changes induced by external stimuli.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23685356 2013 HOT1 is a mammalian direct telomere repeat-binding protein contributing to telomerase recruitment.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
22527283 2012 An enhanced H/ACA RNP assembly mechanism for human telomerase RNA.
21269460 2011 Initial characterization of the human central proteome.
20797632 2010 A proteomic screen for nucleolar SUMO targets shows SUMOylation modulates the function of Nop5/Nop58.
20351177 2010 Specificity and stoichiometry of subunit interactions in the human telomerase holoenzyme assembled in vivo.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
20008900 2010 Effects of dyskeratosis congenita mutations in dyskerin, NHP2 and NOP10 on assembly of H/ACA pre-RNPs.
19179534 2009 A human telomerase holoenzyme protein required for Cajal body localization and telomere synthesis.
19135898 2009 Purification of proteins associated with specific genomic Loci.
18523010 2008 Mutations in the telomerase component NHP2 cause the premature ageing syndrome dyskeratosis congenita.
18482256 2009 Protein microarray analysis identifies human cellular prion protein interactors.
18082603 2007 Purification of human telomerase complexes identifies factors involved in telomerase biogenesis and telomere length regulation.
15889794 [The NOLA2 and RPS3A genes as highly informative markers for human squamous cell lung cancer].
15814878 2005 Mutations in TERT, the gene for telomerase reverse transcriptase, in aplastic anemia.
15635413 2005 Nucleolar proteome dynamics.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15372022 2004 The DNA sequence and comparative analysis of human chromosome 5.
15044956 2004 Architecture and assembly of mammalian H/ACA small nucleolar and telomerase ribonucleoproteins.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12429849 2002 Functional proteomic analysis of human nucleolus.
12020816 2002 Expression of the human homologue of the small nucleolar RNA-binding protein NHP2 gene during monocytic differentiation of U937 cells.
11790298 2002 Directed proteomic analysis of the human nucleolus.
11074001 2000 Human H/ACA small nucleolar RNPs and telomerase share evolutionarily conserved proteins NHP2 and NOP10.
11042152 2000 Cloning and functional analysis of cDNAs with open reading frames for 300 previously undefined genes expressed in CD34+ hematopoietic stem/progenitor cells.
9847074 1998 Toward a complete human genome sequence.
9843512 1998 Nhp2p and Nop10p are essential for the function of H/ACA snoRNPs.