Property Summary

NCBI Gene PubMed Count 5
PubMed Score 1.77
PubTator Score 0.17

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (10)

Disease log2 FC p
ependymoma 1.300 2.8e-02
gastric cancer 1.300 8.8e-04
group 4 medulloblastoma 1.400 1.4e-04
hepatocellular carcinoma 1.200 6.5e-06
intraductal papillary-mucinous neoplasm ... 1.300 4.9e-02
medulloblastoma, large-cell 1.300 2.2e-03
osteosarcoma -1.955 6.8e-07
ovarian cancer -1.600 1.5e-05
primitive neuroectodermal tumor 1.200 1.3e-04
psoriasis -1.700 3.7e-04

Gene RIF (1)

AA Sequence

MAAPGGRGRSLSGLLPAQTSLEYALLDAVTQQEKDSLVYQYLQKVDGWEQDLSVPEFPEGLEWLNTEEPI      1 - 70
SVYKDLCGKIVVLDFFTYCCINCIHLLPDLHALEHTYSDKDGLLIIGVHSAKFPNEKVLDNIKSAVLRYN     71 - 140
ITHPMVNDADASLWQELEVSCWPTLVILGPRGNMLFSLIGEGHKDKLFLYTSIALKYYKDRGQIRDNKIG    141 - 210
IKLYKDSLPPSPLLFPGKVTVDQVTDRLVIADTGHHRILVVWKNGQIQYSIGGPNPGRKDGIFSESTFNS    211 - 280
PQGVAIMNNIIYVADTENHLIRKIDLEAEKVSTVAGIGIQGTDKEGGAKGEQQPISSPWDVVFGTSGSEV    281 - 350
QRGDILWIAMAGTHQIWALLLDSGKLPKKNELTKGTCLRFAGSGNEENRNNAYPHKAGFAQPSGLSLASE    351 - 420
DPWSCLFVADSESSTVRTVSLKDGAVKHLVGGERDPMNLFAFGDVDGVGINAKLQHPLGVTWDKKRNLLY    421 - 490
VADSYNHKIKVVDPKTKNCTTLAGTGDTNNVTSSSFTESTFNEPGGLCIGENGELLYVADTNNHQIKVMD    491 - 560
LETKMVSVLPIFRSENAVVDGPFLVEKQKTLPKLPKSAPSIRLSPVTACAGQTLQFKLRLDLPSGSKLTE    561 - 630
GVSSCWFLTAEGNEWLLQGQIAAGDIENISSQPTISLQIPDDCLSLEAIVSVSVFLYYCSADSSACMMKA    631 - 700
ILFSQPLQITDTQQGCIAPVELRYVF                                                701 - 726
//

Text Mined References (9)

PMID Year Title