Property Summary

NCBI Gene PubMed Count 258
PubMed Score 1124.99
PubTator Score 711.81

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
psoriasis -2.100 4.8e-04
osteosarcoma -2.085 2.6e-02
adrenocortical carcinoma -1.505 1.4e-10
adult high grade glioma 1.600 3.8e-03
pilocytic astrocytoma 1.700 6.6e-04
sonic hedgehog group medulloblastoma 2.000 4.8e-03
non-inflammatory breast cancer -2.300 9.9e-06

Gene RIF (185)

PMID Text
26897248 High p75NTR expression is associated with esophageal cancer.
26700963 Studies indicate that neurotrophin receptor p75(NTR) mediates Huntington's disease-associated synaptic and memory dysfunction.
26646181 RIP2 and RhoGDI bind to p75(NTR) death domain at partially overlapping epitopes with over 100-fold difference in affinity, revealing the mechanism by which RIP2 recruitment displaces RhoGDI upon ligand binding.
26462037 Findings show no association of SNPs in NTRK2 and NGFR genes with completed suicide in Slovenian population.
26408608 The percentage of p75NTR+ peripheral blood mononuclear cells increased in early stages of chronic obstructive pulmonary disease (I-II), while TrKA+ peripheral blood mononuclear cells increased in late stages (III-IV).
26311773 Activation of p75NTR receptor identified that the receptor predominantly assembles as a trimer in brain tissue.
26278479 NGFR Ser205Leu polymorphism modulates the autonomic vagal outflow to the heart, particularly in men.
26122862 there are 15 positive studies among 30 studies regarding BDNF/TRKB/P75NTR polymorphisms antidepressant efficacy in depressed patients--{REVIEW}
26119933 preventing phosphorylation of p75(NTR) by pharmacological inhibition of PKA, or by a mutational strategy, cripples p75(NTR)-mediated glioma invasion resulting in serine phosphorylation within the C-terminal PDZ-binding motif (SPV) of p75(NTR).
26093937 assessment of NF-E2 and NGFR expression may provide additional support in reaching a correct diagnosis in discriminating polycythemia vera from prefibrotic/fibrotic primary myelofibrosis and essential thrombocythemia
25816145 Study found that NGF and p75NTR mRNA expression levels in liver tissues with hepatic fibrosis (viral or not) were up-regulated and they can regulate the course of the disease by decreasing or inhibiting hepatocyte regeneration and proliferation.
25748048 p75(NTR) and alpha9 integrin subunit are not closely associated through their cytoplasmic domains, most probably because of the molecular interference with other cytoplasmic proteins such as paxillin.
25739328 expression of HIF-1alpha and CD271 in melanomas at different phases of progression, as evaluated by histology and reflectance confocal microscopy
25666623 Data indicate that leucine-rich repeat neuronal protein 1 (LINGO-1) is intracellular and competes with Nogo-66 receptor (NgR) for binding to p75 neurotrophin receptor (p75NTR).
25613138 The gene expression of nerve growth factor receptor is significantly upregulated in both clade B and clade C Tat treated SK-N-MC neuroblastoma cells
25509351 almost all of the CD271+ cells are from hematopoietic origin and the frequency of MSCs is so low that possibly during the process of cell isolation most of them are lost and the isolation fails.
25491371 NGF and its precursor proNGF are primarily considered as regulators of neuronal function that induce their responses via the tyrosine kinase receptor TrkA and the panneurotrophin receptor p75NTR. (Review)
25351876 CD271 expression is associated with stage and lymph node metastasis in esophageal squamous cell carcinoma specimens.Epigenetic regulation of CD271 is associated with chemoresistance and metastatic capacity in esophageal squamous cell carcinoma.
25330297 CD271 is critical for keratinocyte differentiation and regulates the transition from keratinocyte stem cells to transit-amplifying cells.
25329094 Isoflurane but not sevoflurane or desflurane postexposure aggravates neurotoxicity in preinjured neurons via activation of p75 and NF-kappaB.
25321086 Case Report: strong p75 staining in cutaneous squamous cell carcinoma.
25244921 p75NGFR is a candidate tumor suppressor and has independent prognostic potential in colorectal cancer.
25227100 Therefore, the 12 selected SNPs may act as tag SNPs for the entire p75NTR gene in Chinese Han population.
25200140 Data indicate that p75 neurotrophin receptor p75(NTR) could be a potential therapeutic target for retinal pigment epithelium (RPE) hypoxia or oxidative stress diseases.
25180603 p75(NTR) mediates synaptic, learning, and memory dysfunction in Huntington's disease
25149537 Data are the first to demonstrate that CD271 more specifically identifies the TIC subpopulation within the CD44+ compartment in SCCHN and that this receptor is a functionally active and targetable molecule.
25093680 These results suggest a mechanism involving both the transmembrane domain and the death domain of p45 to regulate p75-mediated signaling.
24976126 p75(NTR) signaling provides a prosurvival response in vestibular schwannoma cells by activating NF-kappaB independent of JNK
24905361 The ATF4/p75NTR/IL-8 signal pathway may have an important role in EndoMT induced by SFO.
24831840 fetal CD271(+) cells were found in the peri-sinusoidal space and around portal vessels, whereas adult CD271(+) cells were found mainly in the portal connective tissue and in the walls of the portal vessels
24825909 Increased NGFR expression is associated with spontaneous abortions.
24799129 data strongly suggest that CD271 is a crucial determinant of stem-like properties of melanoma cells like colony-formation and tumorigenicity.
24604282 CD271(+) cells developed into neurospheres and could be differentiated into astrocytes, neurons, and oligodendrocytes
24590808 CD271(+) cells were increased in HERV-H(+)CCL19(+) tumor tissues.
24582280 p75NTR signaling associated with trk receptors promotes both cell proliferation and osteoblast differentiation.
24519935 p75NTR mediates proliferation of brain tumor-initiating cells (BTICs) via its cleavage and release of an intracellular domain.
24481864 elucidating the potential implications of p75(NTR) activity as well as the underlying molecular mechanisms of p75(NTR) will shed new light on the biology of both normal and cancer stem cells.
24413464 A ligand-receptor complex SCRG1/BST1 axis facilitate mesenchymal stem cells migration, preserve OCT4 and CD271 expression, self-renewal and osteogenic differentiation.
24226422 We showed that overexpression of CD271 on melanoma cells suppressed the in vitro activation of melanoma-specific cytotoxic T lymphocytes.
24047966 study found that the absence of depressive symptoms in African American and Caucasian female HIV-positive subjects is associated with a genetic variation of the TrkB but not with BDNF or p75 genes respectively
24026251 Ethanol increases p75NTR expression, and CK2 and ERK signaling inversely regulate Sp1-mediated p75NTR expression.
23975178 Allosuppressive potential demonstrated that 81.8% of CD271-bone marrow mononuclear cell (MSC) clones were highly allosuppressive compared to only 58% of plastic adherence-MSC clones.
23831066 p75 neurotrophin receptor cleavage may have a role in its pro-survival effect in breast cancer cells
23820422 Data suggest that expression of neuronal markers NGFp75 (p75 neurotrophin receptor), PGP9.5 (ubiquitin C-terminal hydroxylase-L1, human), and VR1 (vanilloid receptor 1) in endometrium of women is independent of presence of endometriosis.
23642664 Integrin beta-1(+) and p75NTR(+) cells play an important role in wound healing process
23626764 CD271 defines a stem cell-like population in hypopharyngeal cancer, and its expression correlates with prognosis and survival.
23616554 Tetraploidy mainly affects long-range projection neurons, facilitated by p75NTR in the neocortex.
23600400 HIV-mediated neurological impairment could result from altered BDNF/TrkB/p75NTR regulation and function
23598854 Report significant overlap of p75NTR immunoreactivity in desmoplastic trichoepithelioma, infiltrative basal cell carcinoma, and microcystic adnexal carcinoma.
23598407 The p75(NTR)/TrkB imbalance induced by mutant huntingtin in striatal cells associated with the aberrant activity of PP1 disturbs BDNF neuroprotection likely contributing to increasing striatal vulnerability in Huntington's disease.
23576602 High p75NTR expression is associated with glioma.
23489213 The change in expression of neurotrophic factors in KC (keratoconus) may suggest that these factors play an important role in the pathogenesis of KC and serve as new markers for the progression of KC.
23471969 the juxtamembrane region of p75(ICD) acts to cause a conformational change within the extracellular domain of TrkA.
23371454 High p75NTR levels are associated with supratentorial ependymomas.
23300742 CD271 positive pancreatic stellate cells may play a role in the resistance to pancreatic carcinogenesis and progression of pancreatic cancer.
23268325 NGFR expression could be a potential marker for specific molecular subtypes of breast cancer.
23260665 Dissociation of c-Jun kinase (JNK) and caspase-3 activities indicated that JNK is necessary but not sufficient for p75(NTR)-mediated cell death.
23105113 although the intracellular domain of sortilin does not contribute to p75(NTR) binding, it does regulate the rates of p75(NTR) cleavage, which is required to mediate pro-neurotrophin-stimulated cell death.
23105112 The effects of transmembrane sequence and dimerization on cleavage of the p75 neurotrophin receptor by gamma-secretase
23065828 Soluble ST2 is regulated by p75 neurotrophin receptor and predicts mortality in diabetic patients with critical limb ischemia.
22954667 Notably, nerve growth factor (NGF) as well as pro-NGF can fully revert long term potentiation deficits in amyloid-beta protein precursor-null mice through p75NTR and c-Jun kinase pathway.
22932111 The expressions of NGF, TrkA and P75NTR mRNA were suppressed by gonadotropin releasing hormone agonist in eutopic endometrial stromal cells.
22710983 preservation of direct CD271+ MSC/CD34+ HSPC contact across benign and neoplastic marrow suggests a physiologically important role for the CD271+ MSC/CD34+ HSPC relationship and abnormal exposure of CD34+ HSPCs to increased MSC CXCL12 expression in MDS
22706116 The structure of p75NTR and its role in the regulation of survival, growth and induction of apoptosis are discussed in this review.
22635104 Amyloid-beta(1-42) oligomers p75 neurotrophin receptor expression stimulates the hippocampus through IGF-1 receptor signaling.
22566094 Data show that p75NTR and BFAR co-localized within the cytoplasm.
22558167 NGFR gene has a predicted intronic microRNA with a potential pro-apoptotic function.
22454143 There is no significant difference in the NGF, NT-3 and p75NTR expression in the myometrium or endometrium between the adenomyosis and the control group.
22419851 study found that the vasculogenic mimicry (VM)-forming uveal melanoma cell subpopulation in 3D cultures expressed CD271; cells grown in 2D cultures and tumor cell subpopulations not participating in VM formation in 3D cultures were negative for CD27
22343487 expression of neurotrophin receptors Pan-Trk, p75 neurotrophin receptor (p75(NTR) and ciliary neurotrophic factor receptor-alpha in ulveal melanoma does not show a role in growth.
22236693 Inherited polymorphisms of NGFR were associated with the risk of Alzheimer's disease.
22207443 P75 NGF-R is a useful marker to distinguish SCM from other spindle cell neoplasms of sun-damaged skin.
22170235 These results suggest that p75NTR is expressed in undifferentiated cell populations in OL and OSCC. Furthermore, p75NTR is possibly involved in invasion and poor prognosis in OSCC.
22161836 data indicate that overexpression of p75(NTR) induces proteome modifications in breast cancer cells and provide information on how this receptor contributes in tumor cell resistance to apoptosis
22138126 NGF receptors are localized in the mitochondrial compartment of undifferentiated human podocytes and in all tissues analyzed including rat central nervous system.
22068036 determined that the tumor suppressors CLU, NGFR, and RUNX3 were also directly repressed by EZH2 like CASZ1 in NB cells
22040987 The increased NGF level in serum and decreased CD271 expression on bone marrow leukemic cells in B-ALL patients are related with leukemia development.
21938001 The present study provided support for the previously reported association between the Ser205Leu polymorphism of the p75(NTR) gene and major depressive disorder (MDD).
21851375 neurotrophin signalling through p75NTR may mediate a tissue-protective response to inflammation in skeletal myofibres
21814043 extracellular domain of p75NTR, the neurotrophin receptor, plays an important role in the solubility of amyloid beta (Abeta) and might be one of the endogenous mechanisms in the regulation of Abeta plaque formation.
21807134 MSCs were enumerated using colony-forming-unit-fibroblast assays and flow cytometry for the presence CD271(+) multipotential stromal cells population.
21503896 Neurotrophins act through low-affinity receptor p75NTR and the high-affinity receptors dermal fibroblasts and myofibroblasts (DM) synthesize and secrete all NTs and express NT receptors. .
21418516 The induction of APR-1 expression caused apoptosis of melanoma cells via the interaction with the juxtamembrane region of p75 neurotrophin receptor.
21397006 The balance of NGF expression and that of its receptors shifts toward cell death mechanisms during the progression of Alzheimer disease.
21393506 Observation that a relatively high frequency of CD271/Sox10-positive cells correlates with higher metastatic potential and worse prognosis further supports that CD271-positive cells within human melanoma represent genuine cancer stem cells.
21343882 p75NTR is a novel marker of human differentiation-prone muscle precursor cells that is involved in myogenesis
21307265 This study suggested that p75NTR plays a critical role in regulating Abeta levels by both increasing Abeta production and attenuating its aggregation, and they caution that a therapeutic intervention simply reducing p75NTR may exacerbate AD pathology
21178583 findings further suggest that NGFR is not a suitable marker to evaluate reexcision scars for desmoplastic melanoma, especially as a sole marker, as its specificity is low
21151024 p75NTR has a pro-apoptotic role in keratinocytes and is involved in the maintenance of epidermal homeostasis.
21142793 CD271/p75(NTR) inhibits the differentiation of mesenchymal stem cells into osteogenic, adipogenic, chondrogenic, and myogenic lineages.
21123453 By directly connecting MYCN to the repression of TRKA and p75NTR, findings establish a key pathway of clinical pathogenicity and aggressiveness in neuroblastoma.
21097678 Pretreatment of PC-3 cells with p75(NTR) and Nag-1-specific siRNA shows that NSAID inhibition of cell migration is mediated by Nag-1 and p75(NTR).
20943663 TrkA activity is neuroprotective, while p75NTR activity is neurotoxic through a paracrine mechanism in retinal neurodegeneration
20854189 levonorgestrel-releasing intrauterine system significantly reduced the expression of the NGF receptor, NGFR p75, in the endometrium and myometrium of patients with adenomyosis.
20680101 These observations indicate that human corneal endothelial cells are receptive to the action of NGF and that these cells may regulate NGF activity through autocrine/paracrine mechanisms.
20659559 LINGO-1 inhibits multiple aspects of oligodendrocyte differentiation independently of the LRRs via a process that requires p75(NTR) signalling
20596026 Transplantation of isolated CD271(+) melanoma cells into engrafted human skin or bone in Rag2(-/-)gammac(-/-) mice resulted in melanoma; however, melanoma did not develop after transplantation of isolated CD271(-) cells
20549701 Loss of p75(NTR) is associated with medulloblastoma.
20530577 Data suggest that generation of the soluble p75NTR intracellular domain by Trk-induced cleavage plays a fundamental role in Trk-dependent signaling events.
20503287 Observational study of gene-disease association. (HuGE Navigator)
20351714 Observational study of gene-disease association. (HuGE Navigator)
20237496 Observational study of gene-disease association. (HuGE Navigator)
20219210 Observational study of gene-disease association. (HuGE Navigator)
20022966 the p75 ICD generated by gamma-secretase cleavage is capable of modulating transcriptional events in the nucleus.
19945432 the R100 mutation selectively disrupts binding of hNGF to p75NTR receptor, to an extent which depends on the substituting residue at position 100, while the affinity of hNGFR100 mutants for TrkA receptor is not affected.
19918800 p75 re-expression in stromal SMC is a further mechanism related to the general de-differentiation of the stroma connected to the neoplastic invasion.
19758188 Studies indicate that the recognition of a pathologic role of NGF and its receptor system has provided an attractive opportunity to develop a novel class of therapeutics for inflammatory diseases and chronic pain syndromes.
19615036 P75 NGFR may play a mechanistic role in invasive malignant melanomas demonstrating perineural invasion.
19598235 Observational study of gene-disease association. (HuGE Navigator)
19490633 Nerve growth factor receptor was found to be expressed in the synovial fluid of patients with rheumatoid arthritis or spondyloarthritis.
19386345 Expression pattern of NGFR in olfactory neuroblastoma is reported.
19301169 Selection of CD271(+) cells allows a large expansion of mesenchymal stromal cells from human bone marrow
19258923 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19240061 Observational study of gene-disease association. (HuGE Navigator)
19177265 Upregulation of NGF/TrkA in proinflammatory cytokine-activated fibroblast synovial cells suggest cross talk between NGF/NGFR and cells
19169037 In kidney disease, p75 plays a role in both survival & death of cells, depending on absence of ligand, cytoplasmic/ligand interaction and interaction with TrkA.
19131967 These data establish Sall2 as a link between p75 neurotrophin receptor and transcriptional events that regulate the growth and development of neuronal cells.
19086053 Observational study of gene-disease association. (HuGE Navigator)
19072833 Whereas fibrosis develops in the absence of p75(NTR) signaling, the dominant effects of loss of p75(NTR) ligand-mediated events are the retardation of liver fibrosis resolution via regulation of hepatic myofibroblast proliferation and apoptosis.
19066726 The persistence of p75NTR in a small group of medulloblastomas raises the possibility that in such tumors, the receptor could be a potential therapeutic target.
19041213 p75(NGFR) expression may be involved in the perineural invasion of pancreatic cancer cells, and the mechanism might be through mediating the chemoattraction of cancer cells for neural tissues.
18780967 Observational study of gene-disease association. (HuGE Navigator)
18566344 Intramuscular p75(NTR) gene delivery impairs neovascularization and blood flow recovery in a mouse model of limb ischemia.
18540978 The combination of p75(NTR) expression and the pattern of invasion strongly increased precision in the identification of oral squamous carcinomas with poor disease-free survival.
18477014 The demonstration of an increased level of p75NTR gene transcription in lesional mast cells points to an induction of low-affinity neurotrophin receptor sensitivity of mast cells under states of allergic inflammation
18470533 Data show that NGFR expression changes during the years of greatest risk for the development of schizophrenia.
18462868 we provided the evidence that p75NTR was a potential tumor suppressor
18428117 Observational study of gene-disease association. (HuGE Navigator)
18394312 CD271 serves as a receptor for the pro-forms of these neurotrophins and is differentiated from other members of the TNFR receptor family in that it binds pro and mature neurotrophins and affects the growth of the nervous system.
18319596 A potential role of all neurotrophins, through their different receptors, in pituitary functions.
18305571 Melanoma cells express the low-affinity (p75NTR) and the high-affinity tyrosine kinase NT receptors (Trk).
18221326 Basal keratinocytes in oral lichen planus showed no or only weak cytoplasmic staining but in normal oral mucosa there was a clear cell membrane staining
18203754 Observational study of gene-disease association. (HuGE Navigator)
18196575 p75(NTR) suppresses progression of human retinoblastoma and is a potential target for therapy.
18081157 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18036543 A high expression of p75NGFR was often seen with better function of the transplanted muscle.p75NGFR expression might be a contributing factor in successful axonal regeneration.
17971243 in astrocytomas, Trk receptors (TrkA, TrkB, TrkC) expression, but not p75NTR may promote tumor growth independently of grade
17947706 Nerve growth factor facilitates TLR4 signaling-induced maturation of human dendritic cells through LPS-up-regulated p75(NTR) via activation of p38 MAPK and NF-kappaB pathways
17850422 Differential expression throughout the epithelium suggests a role in epithelial differentiation
17703412 Observational study of gene-disease association. (HuGE Navigator)
17696644 These results provide the first evidence for p75(NTR) as a major contributor to the highly invasive nature of malignant gliomas and identify a novel therapeutic target.
17619016 Data show that functional cooperation between TrkA and p75(NTR) accelerates neuronal differentiation by increased transcription of GAP-43 and p21(CIP/WAF) genes via ERK1/2 and AP-1 activities.
17603629 Significantly decreased p75 neurotrophin receptor expression is associated with gastric cancer
17582777 p75NTR downstream signalling is altered by PS2 mutation or gamma-secretase inhibition in SHSY-5Y cel
17531524 trkA(NGFR) and p75(NTR) have roles with nerve growth factor in the healing process as a result of injury [review]
17510309 p75NTR had the function of inhibiting the invasive and metastatic abilities of gastric cancer cells, which was mediated, at least partially, by down-regulation of uPA and MMP9 proteins and up-regulation of TIMP1 protein.
17492429 p75 neurotrophin receptor forms may have a role in type 2 diabetic patients
17357149 results do not support an association of the p75(NTR) S205L polymorphism with risk for childhood-onset mood disorder(COMD)or suicide attempt in COMD
17349981 The novel finding that a mutation may increase processing of p75NTR may have implications for the pathogenic outcome in Alzheimer's disease
17287525 Conserved elements were found in the 25 kb upstream sequences of the human p75NTR gene. Only 1 of these, a proximal region rich in Sp1 sites, responds to changes in hypo-osmolarity.
17196528 We propose that TrkA and p75 likely communicate through convergence of downstream signaling pathways and/or shared adaptor molecules, rather than through direct extracellular interactions.
17110619 p75 is a potential marker of oral keratinocyte stem/progenitor cells and that some neurotrophin/p75 signaling affects cell growth and survival.
16951226 The p75NTR is necessary for survival and maintenance of esophageal squamous cell carcinoma (ESCC), providing us with a potential target for novel therapies.
16893414 This review focuses on the interactions between Abeta and p75NTR in the context of the broader p75NTR signalling field, and offers alternative explanations for how p75NTR might contribute to the etiology of Alzheimer's disease.
16826429 Expressions of p75(NTR) and heparanase-1 correlated with each other in medulloblastoma.
16704535 Elevated p75NGFR expression is associated with a favorable prognosis in human pancreatic cancer.
16586073 In dermis of atopic dermatitis (AD), the intensity of p75 NGFr-IR nerves was stronger in areas of increased numbers of NGF-IR cells. Nerve growth factor and its receptors may contribute to the neurohyperplasia of AD.
16555252 Loss of p75 neurotrophin receptor expression accompanies malignant progression to human and murine retinoblastoma
16460673 p75(NTR) retarded cell cycle progression by induced accumulation of cells in G0/G1 and a reduction in the S phase of the cell cycle.
16215672 p75(NTR) and Fas receptors could share common signalling pathways.
16099913 trimeric oligomerization state of Rabies virus G protein is required for binding with p75NTR
15784962 signaling pathway in which Abeta peptide binds to p75NTR and activates p38 and JNK in a DD-dependent manner, followed by NF-kappaB translocation and p53 activation cause neuron death
15721744 This review focuses on p75NTR as a facilitator of Trk receptor tyrosine kinase-mediated neuronal survival and as a regulator of neuronal cell death--opposing roles dictated by distinct partnering molecules.
15701642 In rat, p75 neurotrophin receptor cleavage by alpha-secretase and gamma-secretase requires specific receptor domains.
15681836 pro-NGF purified from AD human brains can induce apoptosis in neuronal cell cultures through its interaction with the p75NTR receptor
15523689 expression of NGF and its receptors, TrkA and p75NTR, in hepatocellular carcinomas (HCC); NGF and its receptors are thought to have a role in cellular interactions involving HCC cells, hepatic stellate cells, arterial cells and nerve cells in HCC tissues
15337528 c-Cbl-dependent ubiquitination of p75NTR involved in the regulation of p75NTR signalling.
15310753 Data show that sustained activation of p38(MAPK) is essential for the death cascade following exposure of Ewing's sarcoma tumor cells to bFGF and provide evidence that activation of p38(MAPK) results in an up-regulation of the death receptor p75(NTR).
15274039 Observational study of gene-disease association. (HuGE Navigator)
15165637 p75-NGFR expression is observed in fetuses from 15 weeks of gestation in the borderline between pars intermedia and the neurohypophysis.
15015775 p75NTR activation has diverse effects on neuroblastomas.
14689592 The p75(NTR)-mediated trophic support profoundly affects competitive melanoma-cell survival when the tumor cell microenvironment becomes growth limiting.
12963025 Using yeast two-hybrid systems, RanBPM was identified as a binding partner of p75(NTR).
12913006 gamma-secretase-mediated p75NTR proteolysis plays a role in the formation/disassembly of the p75-TrkA receptor complex by regulating the availability of the p75 TM domain that is required for this interaction
12821936 p75(NTR) has a role in differentiation of human esophageal keratinocyte stem cells
12821676 p75 neurotrophin receptor (p75NTR) expression is induced by osmotic swelling via nitric oxide
12768436 Observational study of genotype prevalence. (HuGE Navigator)
12682012 Data describe the identification of a variant of the beta catalytic subunit of cyclic AMP-dependent protein kinase (PKACbeta) as a p75 neurotrophin receptor(NTR)-interacting protein, which phosphorylates p75(NTR) at Ser304.
12672029 p75(NTR) tumor suppressor induces caspase-mediated apoptosis in bladder tumor cells
12604596 tumor necrosis factor receptor-associated death domain protein (TRADD) interacts with p75(NTR) upon nerve growth factor (NGF) stimulation in breast cancer cells
12460612 p75(NTR) may be involved in the formation of tangles in the Alzheimer process.
12422217 P75 interacts with the Nogo receptor as a co-receptor for Nogo, MAG (myelin-associated glycoprotein) and OMgp
12163480 Rabies virus glycoprotein (RVG) is a trimeric ligand for the N-terminal cysteine-rich domain of this protein
11927634 results indicate that neurons expressing p75(NTR), mostly if expressing also proinflammatory cytokine receptors, might be preferential targets of the cytotoxic action of Abeta in Alzheimer's disease (p75 neurotrophin receptor)
11818506 Nerve growth factor regulates dopamine D(2) receptor expression in prolactinoma cell lines via p75(NGFR)-mediated activation of nuclear factor-kappaB

AA Sequence

MGAGATGRAMDGPRLLLLLLLGVSLGGAKEACPTGLYTHSGECCKACNLGEGVAQPCGANQTVCEPCLDS      1 - 70
VTFSDVVSATEPCKPCTECVGLQSMSAPCVEADDAVCRCAYGYYQDETTGRCEACRVCEAGSGLVFSCQD     71 - 140
KQNTVCEECPDGTYSDEANHVDPCLPCTVCEDTERQLRECTRWADAECEEIPGRWITRSTPPEGSDSTAP    141 - 210
STQEPEAPPEQDLIASTVAGVVTTVMGSSQPVVTRGTTDNLIPVYCSILAAVVVGLVAYIAFKRWNSCKQ    211 - 280
NKQGANSRPVNQTPPPEGEKLHSDSGISVDSQSLHDQQPHTQTASGQALKGDGGLYSSLPPAKREEVEKL    281 - 350
LNGSAGDTWRHLAGELGYQPEHIDSFTHEACPVRALLASWATQDSATLDALLAALRRIQRADLVESLCSE    351 - 420
STATSPV                                                                   421 - 427
//

Text Mined References (262)

PMID Year Title
26897248 2016 Detection of circulating tumor cells by p75NTR expression in patients with esophageal cancer.
26700963 2016 p75NTR in Huntington's disease: beyond the basal ganglia.
26646181 2015 Structural basis of death domain signaling in the p75 neurotrophin receptor.
26462037 2015 Investigating the associations between polymorphisms in the NTRK2 and NGFR genes and completed suicide in the Slovenian sample.
26408608 2016 A role for NGF and its receptors TrKA and p75NTR in the progression of COPD.
26311773 2015 Detection of p75NTR Trimers: Implications for Receptor Stoichiometry and Activation.
26278479 2015 Functional Ser205Leu polymorphism of the nerve growth factor receptor (NGFR) gene is associated with vagal autonomic dysregulation in humans.
26268439 2015 p75(NTR)-dependent activation of NF-?B regulates microRNA-503 transcription and pericyte-endothelial crosstalk in diabetes after limb ischaemia.
26122862 2015 BDNF/TRKB/P75NTR polymorphisms and their consequences on antidepressant efficacy in depressed patients.
26119933 2016 Glioma invasion mediated by the p75 neurotrophin receptor (p75(NTR)/CD271) requires regulated interaction with PDLIM1.
26093937 2015 Nuclear factor-erythroid 2, nerve growth factor receptor, and CD34-microvessel density are differentially expressed in primary myelofibrosis, polycythemia vera, and essential thrombocythemia.
25816145 2015 NGF and P75NTR gene expression is associated with the hepatic fibrosis stage due to viral and non-viral causes.
25748048 2015 Association of p75(NTR) and ?9?1 integrin modulates NGF-dependent cellular responses.
25739328 2015 Hypoxia-Inducible Factor-1? and CD271 inversely correlate with melanoma invasiveness.
25666623 2015 LINGO-1 protein interacts with the p75 neurotrophin receptor in intracellular membrane compartments.
25509351 [CD271 enrichment does not help isolating mesenchymal stromal cells from].
25491371 2015 NGF and ProNGF: Regulation of neuronal and neoplastic responses through receptor signaling.
25351876 2015 Epigenetic regulation of CD271, a potential cancer stem cell marker associated with chemoresistance and metastatic capacity.
25330297 2015 CD271 mediates stem cells to early progeny transition in human epidermis.
25329094 2014 Isoflurane but not sevoflurane or desflurane aggravates injury to neurons in vitro and in vivo via p75NTR-NF-?B activation.
25321086 2015 P75 neurotrophin receptor expression in squamous cell carcinoma.
25244921 2015 Epigenetic inactivation and tumor-suppressor behavior of NGFR in human colorectal cancer.
25227100 2014 Selection of human p75NTR tag SNPs and its biological significance for clinical association studies.
25200140 2015 Effects of p75 neurotrophin receptor on regulating hypoxia-induced angiogenic factors in retinal pigment epithelial cells.
25180603 2014 Neurotrophin receptor p75(NTR) mediates Huntington's disease-associated synaptic and memory dysfunction.
25149537 2014 CD271 is a functional and targetable marker of tumor-initiating cells in head and neck squamous cell carcinoma.
25093680 2014 Heterodimerization of p45-p75 modulates p75 signaling: structural basis and mechanism of action.
24976126 2014 p75NTR is highly expressed in vestibular schwannomas and promotes cell survival by activating nuclear transcription factor ?B.
24905361 2014 Finding ATF4/p75NTR/IL-8 signal pathway in endothelial-mesenchymal transition by safrole oxide.
24831840 2014 CD271 identifies functional human hepatic stellate cells, which localize in peri-sinusoidal and portal areas in liver after partial hepatectomy.
24825909 2014 Balanced levels of nerve growth factor are required for normal pregnancy progression.
24799129 2014 The nerve growth factor receptor CD271 is crucial to maintain tumorigenicity and stem-like properties of melanoma cells.
24604282 2014 Isolation of neural progenitor cells from the human adult subventricular zone based on expression of the cell surface marker CD271.
24590808 2014 Induction of immunoregulatory CD271+ cells by metastatic tumor cells that express human endogenous retrovirus H.
24582280 The P75 neurotrophin receptor regulates proliferation of the human MG63 osteoblast cell line.
24519935 2014 p75 neurotrophin receptor cleavage by ?- and ?-secretases is required for neurotrophin-mediated proliferation of brain tumor-initiating cells.
24481864 2014 Role of p75 neurotrophin receptor in stem cell biology: more than just a marker.
24413464 2014 Novel SCRG1/BST1 axis regulates self-renewal, migration, and osteogenic differentiation potential in mesenchymal stem cells.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24226422 2014 CD271 on melanoma cell is an IFN-?-inducible immunosuppressive factor that mediates downregulation of melanoma antigens.
24047966 2013 Single-nucleotide polymorphisms in TrkB and risk for depression: findings from the women's interagency HIV study.
24026251 2013 Ethanol induces cell cycle arrest and triggers apoptosis via Sp1-dependent p75NTR expression in human neuroblastoma cells.
23975178 2013 Clonal analysis of multipotent stromal cells derived from CD271+ bone marrow mononuclear cells: functional heterogeneity and different mechanisms of allosuppression.
23831066 2013 Extracellular cleavage of the p75 neurotrophin receptor is implicated in its pro-survival effect in breast cancer cells.
23820422 2013 Expression of neuronal markers in the endometrium of women with and those without endometriosis.
23785138 2013 p75 neurotrophin receptor is a clock gene that regulates oscillatory components of circadian and metabolic networks.
23642664 2013 The epidermal Integrin beta-1 and p75NTR positive cells proliferating and migrating during wound healing produce various growth factors, while the expression of p75NTR is decreased in patients with chronic skin ulcers.
23626764 2013 CD271 defines a stem cell-like population in hypopharyngeal cancer.
23616554 2013 Genetic evidence for p75NTR-dependent tetraploidy in cortical projection neurons from adult mice.
23600400 2013 Synaptic dysfunction in human immunodeficiency virus type-1-positive subjects: inflammation or impaired neuronal plasticity?
23598854 2013 Expression of p75 neurotrophin receptor in desmoplastic trichoepithelioma, infiltrative basal cell carcinoma, and microcystic adnexal carcinoma.
23598407 2013 Imbalance of p75(NTR)/TrkB protein expression in Huntington's disease: implication for neuroprotective therapies.
23576602 2013 ProBDNF and its receptors are upregulated in glioma and inhibit the growth of glioma cells in vitro.
23535732 2013 Identification of 23 new prostate cancer susceptibility loci using the iCOGS custom genotyping array.
23489213 2013 Expression of neurotrophic factors and their receptors in keratoconic cornea.
23471969 2013 An intracellular domain fragment of the p75 neurotrophin receptor (p75(NTR)) enhances tropomyosin receptor kinase A (TrkA) receptor function.
23371454 2013 Supra- and infratentorial pediatric ependymomas differ significantly in NeuN, p75 and GFAP expression.
23300742 2012 CD271? subpopulation of pancreatic stellate cells correlates with prognosis of pancreatic cancer and is regulated by interaction with cancer cells.
23268325 2013 Nerve growth factor receptor (NGFR): a potential marker for specific molecular subtypes of breast cancer.
23260665 2012 Genetic dissection of neurotrophin signaling through the p75 neurotrophin receptor.
23105113 2012 Mapping of the interaction site between sortilin and the p75 neurotrophin receptor reveals a regulatory role for the sortilin intracellular domain in p75 neurotrophin receptor shedding and apoptosis.
23105112 2012 The effects of transmembrane sequence and dimerization on cleavage of the p75 neurotrophin receptor by ?-secretase.
23065828 2012 Soluble ST2 is regulated by p75 neurotrophin receptor and predicts mortality in diabetic patients with critical limb ischemia.
22954667 2013 Age-related changes of hippocampal synaptic plasticity in A?PP-null mice are restored by NGF through p75NTR.
22932111 2012 [Influence of gonadotropin releasing hormone agonist on the expression of mRNA of nerve growth factor and its receptors in eutopic endometrial stromal cells].
22710983 2012 Distinctive contact between CD34+ hematopoietic progenitors and CXCL12+ CD271+ mesenchymal stromal cells in benign and myelodysplastic bone marrow.
22706116 2012 [p75NTR receptor--role in cell growth and apoptosis].
22635104 2012 Involvement of insulin-like growth factor 1 receptor signaling in the amyloid-? peptide oligomers-induced p75 neurotrophin receptor protein expression in mouse hippocampus.
22610502 2012 Genome-wide analysis of polymorphisms associated with cytokine responses in smallpox vaccine recipients.
22566094 2012 p75NTR signal transduction suppressed by BFAR and p75NTR interactions.
22558167 2012 Experimental verification of a predicted intronic microRNA in human NGFR gene with a potential pro-apoptotic function.
22454143 2012 Neurotrophin expression is not affected in uteri of women with adenomyosis.
22419851 2012 Stem cell marker CD271 is expressed by vasculogenic mimicry-forming uveal melanoma cells in three-dimensional cultures.
22343487 2012 Expression of neurotrophin receptors by retinoinvasive uveal melanoma.
22236693 2012 Genetic polymorphisms of nerve growth factor receptor (NGFR) and the risk of Alzheimer's disease.
22207443 2012 P75 nerve growth factor receptor as a useful marker to distinguish spindle cell melanoma from other spindle cell neoplasms of sun-damaged skin.
22170235 2013 Immunohistochemical location of the p75 neurotrophin receptor (p75NTR) in oral leukoplakia and oral squamous cell carcinoma.
22161836 2011 Proteome changes induced by overexpression of the p75 neurotrophin receptor (p75NTR) in breast cancer cells.
22138126 2012 Localization of nerve growth factor (NGF) receptors in the mitochondrial compartment: characterization and putative role.
22068036 2012 EZH2 Mediates epigenetic silencing of neuroblastoma suppressor genes CASZ1, CLU, RUNX3, and NGFR.
22040987 2011 [Clinical significance of serum NGF level and CD271 expression in patients with acute B lymphoid leukemia].
21982860 2012 A secreted protein microarray platform for extracellular protein interaction discovery.
21938001 2011 Support for association between the Ser205Leu polymorphism of p75(NTR) and major depressive disorder.
21851375 2012 The neurotrophin receptor p75NTR is induced on mature myofibres in inflammatory myopathies and promotes myotube survival to inflammatory stress.
21814043 The p75NTR extracellular domain: a potential molecule regulating the solubility and removal of amyloid-?.
21807134 2012 High abundance of CD271(+) multipotential stromal cells (MSCs) in intramedullary cavities of long bones.
21503896 2012 Role of neurotrophins on dermal fibroblast survival and differentiation.
21418516 2012 Apoptosis related protein-1 triggers melanoma cell death via interaction with the juxtamembrane region of p75 neurotrophin receptor.
21397006 2011 Gender differences in neurotrophin and glutamate receptor expression in cholinergic nucleus basalis neurons during the progression of Alzheimer's disease.
21393506 2011 Human CD271-positive melanoma stem cells associated with metastasis establish tumor heterogeneity and long-term growth.
21343882 2011 Human neurotrophin receptor p75NTR defines differentiation-oriented skeletal muscle precursor cells: implications for muscle regeneration.
21307265 2011 p75NTR regulates Abeta deposition by increasing Abeta production but inhibiting Abeta aggregation with its extracellular domain.
21178583 2011 NGFR (p75) expression in cutaneous scars; Further evidence for a potential pitfall in evaluation of reexcision scars of cutaneous neoplasms, in particular desmoplastic melanoma.
21151024 2011 p75 neurotrophin receptor mediates apoptosis in transit-amplifying cells and its overexpression restores cell death in psoriatic keratinocytes.
21142793 2011 CD271/p75(NTR) inhibits the differentiation of mesenchymal stem cells into osteogenic, adipogenic, chondrogenic, and myogenic lineages.
21123453 2011 A SP1/MIZ1/MYCN repression complex recruits HDAC1 at the TRKA and p75NTR promoters and affects neuroblastoma malignancy by inhibiting the cell response to NGF.
21097678 2010 NSAID inhibition of prostate cancer cell migration is mediated by Nag-1 Induction via the p38 MAPK-p75(NTR) pathway.
20943663 2010 Chronic and acute models of retinal neurodegeneration TrkA activity are neuroprotective whereas p75NTR activity is neurotoxic through a paracrine mechanism.
20854189 2010 Effects of LNG-IUS on nerve growth factor and its receptors expression in patients with adenomyosis.
20680101 2010 NGF and NGF-receptor expression of cultured immortalized human corneal endothelial cells.
20659559 2010 LINGO-1-mediated inhibition of oligodendrocyte differentiation does not require the leucine-rich repeats and is reversed by p75(NTR) antagonists.
20596026 2010 Human melanoma-initiating cells express neural crest nerve growth factor receptor CD271.
20549701 2011 p75(NTR) induces apoptosis in medulloblastoma cells.
20530577 2010 The p75NTR intracellular domain generated by neurotrophin-induced receptor cleavage potentiates Trk signaling.
20503287 2010 Interleukin-9 polymorphism in infants with respiratory syncytial virus infection: an opposite effect in boys and girls.
20351714 2011 Poor replication of candidate genes for major depressive disorder using genome-wide association data.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
20219210 2010 Role of the neurotrophin network in eating disorders' subphenotypes: body mass index and age at onset of the disease.
20022966 2010 Nuclear localization of the p75 neurotrophin receptor intracellular domain.
19945432 2010 In vitro receptor binding properties of a "painless" NGF mutein, linked to hereditary sensory autonomic neuropathy type V.
19918800 2010 Novel localization of low affinity NGF receptor (p75) in the stroma of prostate cancer and possible implication in neoplastic invasion: an immunohistochemical and ultracytochemical study.
19758188 2009 NGF and its receptor system: a new dimension in the pathogenesis of psoriasis and psoriatic arthritis.
19615036 2010 Low-affinity nerve growth factor receptor (P75 NGFR) as a marker of perineural invasion in malignant melanomas.
19598235 2009 Genes related to sex steroids, neural growth, and social-emotional behavior are associated with autistic traits, empathy, and Asperger syndrome.
19490633 2009 Nerve growth factor and receptor expression in rheumatoid arthritis and spondyloarthritis.
19386345 2009 Expression patterns of Trk-A, Trk-B, GRP78, and p75NRT in olfactory neuroblastoma.
19301169 2009 Selection of CD271(+) cells and human AB serum allows a large expansion of mesenchymal stromal cells from human bone marrow.
19258923 2009 Genetic susceptibility to respiratory syncytial virus bronchiolitis in preterm children is associated with airway remodeling genes and innate immune genes.
19240061 2009 Coeliac disease-associated risk variants in TNFAIP3 and REL implicate altered NF-kappaB signalling.
19225519 2009 APP binds DR6 to trigger axon pruning and neuron death via distinct caspases.
19177265 The regulatory role of nerve growth factor and its receptor system in fibroblast-like synovial cells.
19169037 2009 Nerve growth factor and its monocyte receptors are affected in kidney disease.
19131967 2009 Sall2 is a novel p75NTR-interacting protein that links NGF signalling to cell cycle progression and neurite outgrowth.
19086053 2009 Identification of new putative susceptibility genes for several psychiatric disorders by association analysis of regulatory and non-synonymous SNPs of 306 genes involved in neurotransmission and neurodevelopment.
19072833 2009 p75 Neurotrophin receptor signaling regulates hepatic myofibroblast proliferation and apoptosis in recovery from rodent liver fibrosis.
19066726 2009 Expression of p75NTR in fetal brain and medulloblastomas: evidence of a precursor cell marker and its persistence in neoplasia.
19041213 2009 Patterns of expression and function of the p75(NGFR) protein in pancreatic cancer cells and tumours.
18780967 2008 SNPs in neurotrophin system genes and Alzheimer's disease in an Italian population.
18566344 2008 Neurotrophin p75 receptor (p75NTR) promotes endothelial cell apoptosis and inhibits angiogenesis: implications for diabetes-induced impaired neovascularization in ischemic limb muscles.
18540978 2008 Nerve growth factor receptor (p75 NTR) and pattern of invasion predict poor prognosis in oral squamous cell carcinoma.
18477014 2008 Pan-neurotrophin receptor p75NTR expression is strongly induced in lesional atopic mast cells.
18470533 2008 Age-related changes in the expression of schizophrenia susceptibility genes in the human prefrontal cortex.
18462868 2008 The inhibitory effect of p75 neurotrophin receptor on growth of human hepatocellular carcinoma cells.
18428117 2008 Neurotrophic factor-related gene polymorphisms and adult attention deficit hyperactivity disorder (ADHD) score in a high-risk male population.
18394312 CD 271 (P75 neurotrophin receptor).
18319596 2008 p75 and TrkC neurotrophin receptors demonstrate a different immunoreactivity profile in comparison to TrkA and TrkB receptors in human normal pituitary gland and adenomas.
18305571 2008 Neurotrophins and their receptors stimulate melanoma cell proliferation and migration.
18221326 2008 NGF and its receptors TrkA and p75NTR in the epithelium of oral lichen.
18203754 2008 Association of NTRK3 and its interaction with NGF suggest an altered cross-regulation of the neurotrophin signaling pathway in eating disorders.
18196575 2008 The p75 NTR neurotrophin receptor is a tumor suppressor in human and murine retinoblastoma development.
18081157 2008 Evidence for association between genetic variants of p75 neurotrophin receptor (p75NTR) gene and antidepressant treatment response in Chinese major depressive disorder.
18036543 2008 P75 nerve growth factor receptor is expressed in regenerating human nerve grafts.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17986144 2007 Metalloproteases and gamma-secretase: new membrane partners regulating p75 neurotrophin receptor signaling?
17971243 2007 Neurotrophin receptors expression and JNK pathway activation in human astrocytomas.
17947706 2007 Nerve growth factor promotes TLR4 signaling-induced maturation of human dendritic cells in vitro through inducible p75NTR 1.
17850422 2007 Nerve growth factor beta/pro-nerve growth factor and their receptors in normal human oral mucosa.
17703412 2007 Genetic susceptibility to respiratory syncytial virus bronchiolitis is predominantly associated with innate immune genes.
17696644 2007 The p75 neurotrophin receptor is a central regulator of glioma invasion.
17619016 2007 Functional cooperation between TrkA and p75(NTR) accelerates neuronal differentiation by increased transcription of GAP-43 and p21(CIP/WAF) genes via ERK1/2 and AP-1 activities.
17603629 2007 p75 neurotrophin receptor suppresses the proliferation of human gastric cancer cells.
17582777 2007 Analysis of alteration of p75NTR processing and signalling by PS2 mutation and gamma-secretase inhibition.
17531524 Nerve growth factor and tissue repair remodeling: trkA(NGFR) and p75(NTR), two receptors one fate.
17510309 2007 p75 neurotrophin receptor inhibits invasion and metastasis of gastric cancer.
17492429 2007 Levels of three distinct p75 neurotrophin receptor forms found in human plasma are altered in type 2 diabetic patients.
17357149 2007 p75(NTR) gene and suicide attempts in young adults with a history of childhood-onset mood disorder.
17349981 2007 Familial Alzheimer's disease presenilin 1 mutation M146V increases gamma secretase cutting of p75NTR in vitro.
17335080 2007 Roles of glial p75NTR in axonal regeneration.
17287525 2007 Hypo-osmolar stress induces p75NTR expression by activating Sp1-dependent transcription.
17196528 2007 Structural and mechanistic insights into nerve growth factor interactions with the TrkA and p75 receptors.
17110619 2007 Identification of human oral keratinocyte stem/progenitor cells by neurotrophin receptor p75 and the role of neurotrophin/p75 signaling.
16997282 2006 NF-kappaB functions in the nervous system: from development to disease.
16951226 2006 The biological role of the low-affinity p75 neurotrophin receptor in esophageal squamous cell carcinoma.
16893414 2006 Does the p75 neurotrophin receptor mediate Abeta-induced toxicity in Alzheimer's disease?
16826429 2006 Heparanase expression and TrkC/p75NTR ratios in human medulloblastoma.
16704535 2006 Expression of nerve growth factor receptors is correlated with progression and prognosis of human pancreatic cancer.
16630834 2006 Ligand-dependent cleavage of the P75 neurotrophin receptor is necessary for NRIF nuclear translocation and apoptosis in sympathetic neurons.
16625196 2006 DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage.
16586073 2006 Increased nerve growth factor and its receptors in atopic dermatitis: an immunohistochemical study.
16555252 2006 Loss of p75 neurotrophin receptor expression accompanies malignant progression to human and murine retinoblastoma.
16460673 2006 The p75(NTR) tumor suppressor induces cell cycle arrest facilitating caspase mediated apoptosis in prostate tumor cells.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16215672 2005 Modulation of Fas-induced apoptosis by p75 neurotrophin receptor in a human neuroblastoma cell line.
16215275 2005 Multiple signals regulate axon regeneration through the Nogo receptor complex.
16099913 2005 Stable trimerization of recombinant rabies virus glycoprotein ectodomain is required for interaction with the p75NTR receptor.
15784962 2005 Characterization of the signaling pathway downstream p75 neurotrophin receptor involved in beta-amyloid peptide-dependent cell death.
15721744 2005 p75NTR--live or let die.
15701642 2005 Cleavage of p75 neurotrophin receptor by alpha-secretase and gamma-secretase requires specific receptor domains.
15681836 2005 Pro-NGF isolated from the human brain affected by Alzheimer's disease induces neuronal apoptosis mediated by p75NTR.
15523689 2005 Expression of NGF in hepatocellular carcinoma cells with its receptors in non-tumor cell components.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15378608 2004 Ternary complex with Trk, p75, and an ankyrin-rich membrane spanning protein.
15337528 2004 c-Cbl binds to tyrosine-phosphorylated neurotrophin receptor p75 and induces its ubiquitination.
15310753 2004 Basic fibroblast growth factor-induced cell death is effected through sustained activation of p38MAPK and up-regulation of the death receptor p75NTR.
15274039 2004 A missense polymorphism (S205L) of the low-affinity neurotrophin receptor p75NTR gene is associated with depressive disorder and attempted suicide.
15165637 2004 p75-NGFR expression in the human prenatal pituitary gland.
15128850 2004 p75 neurotrophin receptor signaling regulates growth cone filopodial dynamics through modulating RhoA activity.
15015775 2004 Neurotrophin effects on neuroblastoma cells: correlation with trk and p75NTR expression and influence of Trk receptor bodies.
14985763 2004 Sortilin is essential for proNGF-induced neuronal cell death.
14966521 2004 LINGO-1 is a component of the Nogo-66 receptor/p75 signaling complex.
14960584 2004 A functional interaction between the p75 neurotrophin receptor interacting factors, TRAF6 and NRIF.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14689592 2004 p75 neurotrophin receptor functions as a survival receptor in brain-metastatic melanoma cells.
14593116 2004 Necdin-related MAGE proteins differentially interact with the E2F1 transcription factor and the p75 neurotrophin receptor.
12963025 2003 RanBPM is a novel binding protein for p75NTR.
12951563 2003 Myelin-associated inhibitors of axonal regeneration in the adult mammalian CNS.
12913006 2003 Regulated intramembrane proteolysis of the p75 neurotrophin receptor modulates its association with the TrkA receptor.
12843241 2003 Proteolytic processing of the p75 neurotrophin receptor and two homologs generates C-terminal fragments with signaling capability.
12821936 2003 Neurotrophin receptor p75(NTR) characterizes human esophageal keratinocyte stem cells in vitro.
12821676 2003 Osmotic swelling induces p75 neurotrophin receptor (p75NTR) expression via nitric oxide.
12789270 2003 Neurotrophin-induced melanoma cell migration is mediated through the actin-bundling protein fascin.
12787561 Ten years on: mediation of cell death by the common neurotrophin receptor p75(NTR).
12768436 2003 Characterization of 458 single nucleotide polymorphisms of disease candidate genes in the Korean population.
12716928 2003 Ligand-induced internalization of the p75 neurotrophin receptor: a slow route to the signaling endosome.
12692556 2003 The p75 receptor acts as a displacement factor that releases Rho from Rho-GDI.
12682012 2003 PKA phosphorylates the p75 receptor and regulates its localization to lipid rafts.
12676795 2003 Trk receptors: roles in neuronal signal transduction.
12672029 2003 The p75(NTR) tumor suppressor induces caspase-mediated apoptosis in bladder tumor cells.
12604596 2003 Tumor necrosis factor receptor-associated death domain protein is involved in the neurotrophin receptor-mediated antiapoptotic activity of nerve growth factor in breast cancer cells.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12460612 2002 Increased p75(NTR) expression in hippocampal neurons containing hyperphosphorylated tau in Alzheimer patients.
12426574 2002 A p75(NTR) and Nogo receptor complex mediates repulsive signaling by myelin-associated glycoprotein.
12422217 2002 P75 interacts with the Nogo receptor as a co-receptor for Nogo, MAG and OMgp.
12414813 2002 The p75 neurotrophin receptor interacts with multiple MAGE proteins.
12376548 2002 NRAGE, a p75 neurotrophin receptor-interacting protein, induces caspase activation and cell death through a JNK-dependent mitochondrial pathway.
12371150 2002 Control of the cell cycle by neurotrophins: lessons from the p75 neurotrophin receptor.
12163480 2002 Rabies virus glycoprotein (RVG) is a trimeric ligand for the N-terminal cysteine-rich domain of the mammalian p75 neurotrophin receptor.
12107411 2002 Expressed sequence tag analysis of human retina for the NEIBank Project: retbindin, an abundant, novel retinal cDNA and alternative splicing of other retina-preferred gene transcripts.
12034707 2002 Identification of interleukin 1 receptor-associated kinase as a conserved component in the p75-neurotrophin receptor activation of nuclear factor-kappa B.
12011108 2002 The p75 receptor transduces the signal from myelin-associated glycoprotein to Rho.
11927634 2002 Role of p75 neurotrophin receptor in the neurotoxicity by beta-amyloid peptides and synergistic effect of inflammatory cytokines.
11830582 2002 Structure-function analysis of NADE: identification of regions that mediate nerve growth factor-induced apoptosis.
11818506 2002 Nerve growth factor regulates dopamine D(2) receptor expression in prolactinoma cell lines via p75(NGFR)-mediated activation of nuclear factor-kappaB.
11756498 2002 Activation of Rac GTPase by p75 is necessary for c-jun N-terminal kinase-mediated apoptosis.
11756426 2002 Amyloid beta binds trimers as well as monomers of the 75-kDa neurotrophin receptor and activates receptor signaling.
11487608 2001 A prosurvival function for the p75 receptor death domain mediated via the caspase recruitment domain receptor-interacting protein 2.
11279055 2001 A diverse family of proteins containing tumor necrosis factor receptor-associated factor domains.
11278287 2001 14-3-3 is involved in p75 neurotrophin receptor-mediated signal transduction.
11244088 2001 The atypical protein kinase C-interacting protein p62 is a scaffold for NF-kappaB activation by nerve growth factor.
11201742 2001 Identification of a receptor mediating Nogo-66 inhibition of axonal regeneration.
11150334 2001 An evolutionarily conserved transmembrane protein that is a novel downstream target of neurotrophin and ephrin receptors.
10985348 2000 NRAGE, a novel MAGE protein, interacts with the p75 neurotrophin receptor and facilitates nerve growth factor-dependent apoptosis.
10764727 2000 NADE, a p75NTR-associated cell death executor, is involved in signal transduction mediated by the common neurotrophin receptor p75NTR.
10595511 1999 Neurotrophin binding to the p75 receptor modulates Rho activity and axonal outgrowth.
10545116 1999 The zinc finger protein NRIF interacts with the neurotrophin receptor p75(NTR) and participates in programmed cell death.
10544233 1999 Functional interaction of Fas-associated phosphatase-1 (FAP-1) with p75(NTR) and their effect on NF-kappaB activation.
10514511 1999 TRAF family proteins interact with the common neurotrophin receptor and modulate apoptosis induction.
10022904 1999 Activation of IkappaB kinase beta by protein kinase C isoforms.
9927421 1999 Biochemical and functional interactions between the neurotrophin receptors trk and p75NTR.
9915784 1999 Association of the p75 neurotrophin receptor with TRAF6.
9867838 1999 Caveolin interacts with Trk A and p75(NTR) and regulates neurotrophin signaling pathways.
9665396 1998 Light and electron microscopic demonstration of the p75 nerve growth factor receptor in normal human cutaneous nerve fibers: new vistas.
9575168 1998 MyD88, an adapter protein involved in interleukin-1 signaling.
9368064 1997 Growth factors stimulate tyrosine dephosphorylation of p75 and its dissociation from the SH2 domain of Grb2.
9252186 1997 A cytokine-responsive IkappaB kinase that activates the transcription factor NF-kappaB.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
8627329 1996 O-linked oligosaccharide on the 75-kDa neurotrophin receptor.
8614797 1996 p75NTR: a receptor after all.
8407983 1993 Association of protein kinases ERK1 and ERK2 with p75 nerve growth factor receptors.
7903404 1993 Nerve growth factor receptor expression in fetal, mature, and diseased human kidneys.
7541633 1995 Differential role of the low affinity neurotrophin receptor (p75) in retrograde axonal transport of the neurotrophins.
7541035 1995 Shc binding to nerve growth factor receptor is mediated by the phosphotyrosine interaction domain.
3022937 1986 Expression and structure of the human NGF receptor.
3020711 1986 Assignment of human nerve growth factor receptor gene to chromosome 17 and regulation of receptor expression in somatic cell hybrids.
3008331 1986 Gene transfer and molecular cloning of the human NGF receptor.
3006050 1986 The nerve growth factor receptor gene is at human chromosome region 17q12-17q22, distal to the chromosome 17 breakpoint in acute leukemias.
2989274 1985 Characterization of the human melanoma nerve growth factor receptor.
2850481 1988 A constitutive promoter directs expression of the nerve growth factor receptor gene.
1846035 1991 Nerve growth factor binding domain of the nerve growth factor receptor.
1324502 1992 Immunocytochemical localization of nerve growth factor receptor (NGFR) in human teeth.
1316918 1992 Functional nerve growth factor receptors on human B lymphocytes. Interaction with IL-2.
1281863 1992 Expression of growth-associated protein 43 and nerve growth factor receptor in human skin: a comparative immunohistochemical investigation.