Property Summary

NCBI Gene PubMed Count 19
PubMed Score 14.43
PubTator Score 7.39

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (19)

Disease log2 FC p
astrocytic glioma -2.700 2.9e-03
ependymoma -2.200 3.0e-02
glioblastoma multiforme -2.800 5.0e-19
oligodendroglioma -2.700 6.6e-15
osteosarcoma 2.144 1.1e-02
medulloblastoma -3.400 1.5e-04
atypical teratoid / rhabdoid tumor -3.000 4.9e-05
medulloblastoma, large-cell -4.300 5.8e-04
primitive neuroectodermal tumor -2.300 6.0e-03
adrenocortical carcinoma -1.992 3.8e-02
non-small cell lung cancer 1.485 1.8e-17
intraductal papillary-mucinous adenoma (... 1.100 3.1e-04
adult high grade glioma -2.100 3.4e-02
pilocytic astrocytoma -1.400 4.4e-02
aldosterone-producing adenoma -1.285 6.9e-03
lung adenocarcinoma 1.600 1.3e-05
Pick disease -1.400 3.2e-02
ulcerative colitis -1.100 1.4e-03
ovarian cancer 1.200 8.0e-04

Gene RIF (5)

PMID Text
26340433 A visceral-fat-associated SNP, rs11678490 of NGEF, was found in Korean men.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19911011 Observational study of gene-disease association. (HuGE Navigator)
18976975 Knockdown of neuronal guanine nucleotide exchange factor (NGEF) by siRNA inhibits HIV-1 replication in HeLa P4/R5 cells
17702745 FGFR-mediated phosphorylation of ephexin1 enhances the guanine nucleotide exchange activity toward RhoA without affecting the activity to Rac1 or Cdc42.

AA Sequence

METRESEDLEKTRRKSASDQWNTDNEPAKVKPELLPEKEETSQADQDIQDKEPHCHIPIKRNSIFNRSIR      1 - 70
RKSKAKARDNPERNASCLADSQDNGKSVNEPLTLNIPWSRMPPCRTAMQTDPGAQEMSESSSTPGNGATP     71 - 140
EEWPALADSPTTLTEALRMIHPIPADSWRNLIEQIGLLYQEYRDKSTLQEIETRRQQDAEIEDNTNGSPA    141 - 210
SEDTPEEEEEEEEEEEPASPPERKTLPQICLLSNPHSRFNLWQDLPEIRSSGVLEILQPEEIKLQEAMFE    211 - 280
LVTSEASYYKSLNLLVSHFMENERIRKILHPSEAHILFSNVLDVLAVSERFLLELEHRMEENIVISDVCD    281 - 350
IVYRYAADHFSVYITYVSNQTYQERTYKQLLQEKAAFRELIAQLELDPKCRGLPFSSFLILPFQRITRLK    351 - 420
LLVQNILKRVEERSERECTALDAHKELEMVVKACNEGVRKMSRTEQMISIQKKMEFKIKSVPIISHSRWL    421 - 490
LKQGELQQMSGPKTSRTLRTKKLFHEIYLFLFNDLLVICRQIPGDKYQVFDSAPRGLLRVEELEDQGQTL    491 - 560
ANVFILRLLENADDREATYMLKASSQSEMKRWMTSLAPNRRTKFVSFTSRLLDCPQVQCVHPYVAQQPDE    561 - 630
LTLELADILNILDKTDDGWIFGERLHDQERGWFPSSMTEEILNPKIRSQNLKECFRVHKMDDPQRSQNKD    631 - 700
RRKLGSRNRQ                                                                701 - 710
//

Text Mined References (21)

PMID Year Title
26340433 2015 A Common Variant of NGEF Is Associated with Abdominal Visceral Fat in Korean Men.
25056061 2014 Biological insights from 108 schizophrenia-associated genetic loci.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24152035 2014 Variants in the 1q21 risk region are associated with a visual endophenotype of autism and schizophrenia.
23974872 2013 Genome-wide association analysis identifies 13 new risk loci for schizophrenia.
21789175 2011 Identification and analysis of intermediate size noncoding RNAs in the human fetal brain.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19911011 2010 Mutation of ARHGAP9 in patients with coronary spastic angina.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17702745 2007 Regulation of ephexin1, a guanine nucleotide exchange factor of Rho family GTPases, by fibroblast growth factor receptor-mediated tyrosine phosphorylation.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15848799 2005 Eph-dependent tyrosine phosphorylation of ephexin1 modulates growth cone collapse.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12787561 Ten years on: mediation of cell death by the common neurotrophin receptor p75(NTR).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12376548 2002 NRAGE, a p75 neurotrophin receptor-interacting protein, induces caspase activation and cell death through a JNK-dependent mitochondrial pathway.
11756498 2002 Activation of Rac GTPase by p75 is necessary for c-jun N-terminal kinase-mediated apoptosis.
11336673 2001 EphA receptors regulate growth cone dynamics through the novel guanine nucleotide exchange factor ephexin.
10777665 2000 Characterization of Ngef, a novel member of the Dbl family of genes expressed predominantly in the caudate nucleus.