Property Summary

NCBI Gene PubMed Count 19
PubMed Score 15.66
PubTator Score 7.39

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (19)

Disease log2 FC p
adrenocortical carcinoma -1.992 3.8e-02
adult high grade glioma -2.100 3.4e-02
aldosterone-producing adenoma -1.285 6.9e-03
astrocytic glioma -2.700 2.9e-03
Astrocytoma, Pilocytic -1.400 4.2e-02
atypical teratoid / rhabdoid tumor -3.000 4.9e-05
ependymoma -2.200 3.0e-02
glioblastoma -1.600 1.1e-02
group 4 medulloblastoma -2.900 3.2e-03
intraductal papillary-mucinous adenoma (... 1.100 3.1e-04
lung adenocarcinoma 1.600 1.3e-05
medulloblastoma, large-cell -4.300 5.8e-04
non-small cell lung cancer 1.485 1.8e-17
oligodendroglioma -2.700 6.6e-15
osteosarcoma 2.144 1.1e-02
ovarian cancer 1.200 8.0e-04
Pick disease -1.400 3.2e-02
primitive neuroectodermal tumor -2.300 6.0e-03
ulcerative colitis -1.100 1.4e-03

Protein-protein Interaction (5)

Gene RIF (5)

AA Sequence

METRESEDLEKTRRKSASDQWNTDNEPAKVKPELLPEKEETSQADQDIQDKEPHCHIPIKRNSIFNRSIR      1 - 70
RKSKAKARDNPERNASCLADSQDNGKSVNEPLTLNIPWSRMPPCRTAMQTDPGAQEMSESSSTPGNGATP     71 - 140
EEWPALADSPTTLTEALRMIHPIPADSWRNLIEQIGLLYQEYRDKSTLQEIETRRQQDAEIEDNTNGSPA    141 - 210
SEDTPEEEEEEEEEEEPASPPERKTLPQICLLSNPHSRFNLWQDLPEIRSSGVLEILQPEEIKLQEAMFE    211 - 280
LVTSEASYYKSLNLLVSHFMENERIRKILHPSEAHILFSNVLDVLAVSERFLLELEHRMEENIVISDVCD    281 - 350
IVYRYAADHFSVYITYVSNQTYQERTYKQLLQEKAAFRELIAQLELDPKCRGLPFSSFLILPFQRITRLK    351 - 420
LLVQNILKRVEERSERECTALDAHKELEMVVKACNEGVRKMSRTEQMISIQKKMEFKIKSVPIISHSRWL    421 - 490
LKQGELQQMSGPKTSRTLRTKKLFHEIYLFLFNDLLVICRQIPGDKYQVFDSAPRGLLRVEELEDQGQTL    491 - 560
ANVFILRLLENADDREATYMLKASSQSEMKRWMTSLAPNRRTKFVSFTSRLLDCPQVQCVHPYVAQQPDE    561 - 630
LTLELADILNILDKTDDGWIFGERLHDQERGWFPSSMTEEILNPKIRSQNLKECFRVHKMDDPQRSQNKD    631 - 700
RRKLGSRNRQ                                                                701 - 710
//

Text Mined References (21)

PMID Year Title