Property Summary

NCBI Gene PubMed Count 76
PubMed Score 364.61
PubTator Score 252.20

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
astrocytic glioma -1.200 9.6e-03
ependymoma -1.800 4.1e-15
oligodendroglioma -1.100 1.6e-02
glioblastoma -1.600 2.2e-05
sonic hedgehog group medulloblastoma -1.400 1.2e-03
atypical teratoid/rhabdoid tumor -1.800 8.9e-08
medulloblastoma, large-cell -1.600 1.1e-04
primitive neuroectodermal tumor -1.200 7.2e-04
pediatric high grade glioma -1.500 7.6e-05
pilocytic astrocytoma -1.700 7.6e-07
pituitary cancer -1.900 3.7e-06

Gene RIF (66)

PMID Text
26556771 Study characterized the presence of Ngb in the human cochlea
26472601 Data show that the mean peak serum neuroglobin and Nogo-A concentrations were both significantly higher in patients with an unfavorable outcome at 6 months after traumatic brain injury (TBI).
26305249 Findings suggest a control model for neuroglobin's anti-apoptotic activity under physiological conditions. While in normoxic conditions, its activity is maintained at low level, an immediate transition to an hypoxic situation increases it drastically.
25683270 17beta-estradiol-induced NGB up-regulation could act as an oxidative stress sensor, which does not oppose to the pro-apoptotic 17beta-estradiol effect in ER beta-containing colon cancer cells unless a rise of oxidative stress occurs.
25552092 This paper for the first time presents the data on neuroglobin distribution in human cerbellum using immunohistochemistry.
25452214 Data show that chimeric neuroglobin and myoglobin were generated by swapping a regulatory segment.
25372753 The review summarizes the recent experimental findings, mainly focusing on the mechanisms of Ngb's protection and induction during ischemic/hypoxic conditions and it roles in astrocytes, tumors, as well as in neurite outgrowth. [review]
25299774 Neuroglobin player role in estrogen receptor alpha-positive cancer cell viability.
24855999 a mechanism for redox control of human Ngb (hNgb) activity
24699645 first X-ray structure of wild-type human neuroglobin is reported at 1.74 A resolution
24446190 Findings indicate that myoglobin (Mb) and neuroglobin (Ngb) can be expressed in nonmuscle and non-neural contexts.
24376733 Glu60 of human Ngb is a crucial residue for its GDI and neuroprotective activities
24362753 analysis of single nucleotide polymorphisms in neuroglobin that affect transcription and possibly Alzheimer's Disease
23835959 Ngb and Cygb are expressed in the solitary tract nucleus and in the carotid body, and may have roles in the processing of cardiovascular and respiratory reflex inputs
23648513 Neuroglobin brain levels are increased in Alzheimer's disease patients compared to controls.
23643985 These findings suggest that neuroglobin is expressed early in the course of neuronal differentiation and may, therefore, have a role in neurodevelopment.
23319379 NGB is expressed in the carotid body of heroin addicts and may have a role in compensating for the negative effects of heroin
23160832 Report neuroglobin expression in human brain.
23135388 functional impact of heme disorder and cysteine oxidation state on the properties of the Ngb ligand
22787149 the oxidative stress-induced structural changes of human Ngb are essential for its neuroprotective activity.
22009023 We found that NGB was present in a rat astrocytoma cell line (C6), human astrocytoma cell line (U251), and human astrocytoma tissues
21965683 14-3-3 binding and phosphorylation of neuroglobin during hypoxia modulate six-to-five heme pocket coordination and rate of nitrite reduction to nitric oxide
21725774 This study demonistrated that Neuroglobin overexpression in brain with arteriovenous malformation and intracerebral hemorrhage.
21704585 The phenylalanine B10 residue of neuroglobin plays a key role in transmitting the structural information from the disulfide bridge to the heme-pocket region.
21674044 Caenorhabditis elegans globin GLB-26 (expressed from gene T22C1.2) has been studied in comparison with human neuroglobin (Ngb) and cytoglobin (Cygb) for its electron transfer properties
21620833 This review describes the discovery of neuroglobin over a decade ago, its structure, affinity for oxygen, and its expression in cerebral neurons, all of which suggest it plays a role in providing oxygen to the brain.
21601304 overexpression in non-small cell lung cancer is associated with histological subtype, hypoxia
21362510 Data suggest a potential role of DNA methylation in regulating NGB tissue-specific expression.
21304818 Cimeric Myoglobin has a cell-membrane-penetrating activity similar to zebrafish Ngb.
21296891 neuroglobin may function as a physiological oxidative stress sensor and a post-translationally redox-regulated nitrite reductase that generates NO under six-to-five-coordinate heme pocket control
21190290 There is a plausible central role for neuroglobin in the control of apoptosis.
20643048 These data favor the hypothesis that the disulfide bond between Cys46 and Cys55 modulates the functioning of human neuroglobin.
20571522 Ngb may confer protection against ischemia-reperfusion injury in the brain through its intrinsic antioxidant properties.
20345238 the haplotype block represented by rs3783988 in neuroglobin appears to influence recovery after severe traumatic brain injury
20345238 Observational study of gene-disease association. (HuGE Navigator)
20227336 The acid-induced denaturation pathway of apo-Ngb can be illustrated from the native state (N), via a partially unfolded state (U(A)) to the molten globule state (MG).
20091232 These data provides an explanation the action of neuroglobin in the protection of nerve cells from unwanted apoptosis.
20075359 Ischemic stroke increases the expresssion of the neuroprotective protein neuroglobin in brain.
19860834 The conformational and functional stability of Ngb at acidic pH was analyzed.
19383366 neuroglobin transcript and protein are expressed in human glioblastoma cells, and this expression increases in hypoxia in vitro
19327369 Results demonstrate by immunohistochemical analysis the colocalization of neuroglobin and PrP(c) in the retinal ganglion cell layer.
19307722 Structure determination by molecular replacement of neuroglobin at 1.8 A resolution showed the apparent space group was orthorhombic C222(1), but the real space group was monoclinic P2(1), due to twinning. It is a perfect hemihedrally twinned crystal.
19087291 Ngb polymorphism 89+104 t had protective effects on large-artery atherosclerosis and small-vessel occlusion in the Southern Chinese Han population
19087291 Observational study of gene-disease association. (HuGE Navigator)
19010568 A significant association was found between Alzheimer disease risk and a variant in the NGB gene. Data is consistent with a model where women, older individuals and carriers of specific genotypes have lower levels of NGB leading to increased risk for AD.
19001220 Neuroglobin and cytoglobin are colocalized within human retinal neurons and retinal pigment epithelium but not within glial cells.
18767815 A feature of Ngb is its heme hexacoordination in the absence of external ligands, observed both in the ferrous and in the ferric (met) forms.
18416560 both zebrafish and chimeric ZHHH Ngb can penetrate cell membranes in the absence of Chariot
18302932 These results clearly show that the GDI activity of human Ngb is tightly correlated with its neuroprotective activity.
17975837 protein oxidation promotes stabilization of pentacoordinated species, thus favoring protein to adopt more reactive state & supporting existence of molecular mechanism where O2 is released under hypoxic conditions, suggesting O(2) storage function for Ngb.
17600531 ferric-NGB acts not only as scavenger of toxic species, but also as a target of the self-generated reactive species
17337004 Sites of interaction between Ngb and Galpha(i).
16201751 analysis of the proximal and distal histidine environment of cytoglobin and neuroglobin
15819897 molecular characterization of human and Drosophila cytoglobulins and neuroglobulins
15808606 TAT-Ngb is an efficient fusion protein capable of protecting the human islets in culture from loss of cell mass and function, thus increasing the quality of transplantable islets.
15723537 Identification of several residues that are crucial for several residues that are crucial for the Guanine nucleotide dissociation inhibitor activity of human Ngb.
15488767 Data show that wild-type human recombinant neuroglobin favors the F8His-Fe2+ -E7His conformation.
15299006 oxygen binding in human neuroglobin and cytoglobin is allosterically regulated and temperature-dependent
15193759 Analysis of the neuroglobin genomic sequence identifies sequence motifs with similarity to the neuron-restrictive silencer element, possibly explaining a neuron-specific expression of neuroglobin.
15122877 Results are the first to demonstrate an interaction between neuroglobin (Ngb) and cystatin C. Ngb may modulate the intracellular transport (or secretion) of cystatin C to protect against neuronal death under conditions of oxidative stress.
14645216 His64 and Lys67 comprise a unique distal heme pocket in neuroglobin
14530264 results suggest a novel mechanism for the regulation of oxygen binding; contact with an appropriate electron donor would provoke the release of oxygen. Hence the oxygen affinity would be directly linked to the redox state of the cell.
12860983 human Ngb may be a novel oxidative stress-responsive sensor for signal transduction in the brain
12351835 an examination of the protein's structure by crystallization and x-ray diffraction
12239161 Expression is induced by hemin in neural cells
11820779 Full-length cDNA cloning and genomic organization of NGB have been reported.

AA Sequence

MERPEPELIRQSWRAVSRSPLEHGTVLFARLFALEPDLLPLFQYNCRQFSSPEDCLSSPEFLDHIRKVML      1 - 70
VIDAAVTNVEDLSSLEEYLASLGRKHRAVGVKLSSFSTVGESLLYMLEKCLGPAFTPATRAAWSQLYGAV     71 - 140
VQAMSRGWDGE                                                               141 - 151
//

Text Mined References (76)

PMID Year Title
26556771 2016 Neuroglobin immunoreactivity in the human cochlea.
26472601 2015 Neuroglobin and Nogo-a as biomarkers for the severity and prognosis of traumatic brain injury.
26305249 2015 A Futile Redox Cycle Involving Neuroglobin Observed at Physiological Temperature.
25683270 2015 ER?-dependent neuroglobin up-regulation impairs 17?-estradiol-induced apoptosis in DLD-1 colon cancer cells upon oxidative stress injury.
25552092 2014 [Neuroglobin distribution in the human cerebellar cortex (an immunohistochemical study)].
25452214 2015 Engineered chimeras reveal the structural basis of hexacoordination in globins: a case study of neuroglobin and myoglobin.
25416956 2014 A proteome-scale map of the human interactome network.
25372753 2014 Neuroglobin - recent developments.
25299774 2014 Neuroglobin, a pro-survival player in estrogen receptor ?-positive cancer cells.
24855999 2014 A possible mechanism for redox control of human neuroglobin activity.
24699645 2014 The crystal structure of wild-type human brain neuroglobin reveals flexibility of the disulfide bond that regulates oxygen affinity.
24446190 2014 Hematopoietic stem/progenitor cells express myoglobin and neuroglobin: adaptation to hypoxia or prevention from oxidative stress?
24376733 2013 Crucial roles of Glu60 in human neuroglobin as a guanine nucleotide dissociation inhibitor and neuroprotective agent.
24362753 2014 Genetic determinants of neuroglobin transcription.
23835959 2013 Cytoglobin and neuroglobin in the human brainstem and carotid body.
23648513 2013 Neuroglobin protein is upregulated in Alzheimer's disease.
23643985 2013 Neuroglobin expression in neurogenesis.
23319379 2013 Human carotid body neuroglobin, vascular endothelial growth factor and inducible nitric oxide synthase expression in heroin addiction.
23160832 2013 Neuroglobin and cytoglobin expression in the human brain.
23135388 2013 Heme orientation modulates histidine dissociation and ligand binding kinetics in the hexacoordinated human neuroglobin.
22787149 2012 Human neuroglobin functions as an oxidative stress-responsive sensor for neuroprotection.
22009023 2012 The expression of neuroglobin in astrocytoma.
21965683 2011 14-3-3 binding and phosphorylation of neuroglobin during hypoxia modulate six-to-five heme pocket coordination and rate of nitrite reduction to nitric oxide.
21725774 2011 Neuroglobin expression in human arteriovenous malformation and intracerebral hemorrhage.
21704585 2011 EPR investigation of the role of B10 phenylalanine in neuroglobin - evidence that B10Phe mediates structural changes in the heme region upon disulfide-bridge formation.
21674044 2011 Electron transfer function versus oxygen delivery: a comparative study for several hexacoordinated globins across the animal kingdom.
21620833 2011 Protection by neuroglobin and cell-penetrating peptide-mediated delivery in vivo: a decade of research. Comment on Cai et al: TAT-mediated delivery of neuroglobin protects against focal cerebral ischemia in mice. Exp Neurol. 2011; 227(1): 224-31.
21601304 2011 The balance between the expressions of hASH1 and HES1 differs between large cell neuroendocrine carcinoma and small cell carcinoma of the lung.
21362510 Functional and sequence analysis of human neuroglobin gene promoter region.
21304818 2011 Module M1 of zebrafish neuroglobin acts as a structural and functional protein building block for a cell-membrane-penetrating activity.
21296891 2011 Human neuroglobin functions as a redox-regulated nitrite reductase.
21190290 2010 A role for human neuroglobin in apoptosis.
20643048 2010 Probing the role of the internal disulfide bond in regulating conformational dynamics in neuroglobin.
20571522 2010 Neuroglobin protects neurons against oxidative stress in global ischemia.
20345238 2010 Neuroglobin genetic polymorphisms and their relationship to functional outcomes after traumatic brain injury.
20227336 2010 Spectroscopic study on acid-induced unfolding and refolding of apo-neuroglobin.
20091232 2010 Neuroglobin protects nerve cells from apoptosis by inhibiting the intrinsic pathway of cell death.
20075359 2010 Neuroglobin expression in ischemic stroke.
19860834 2009 Unusual stability of human neuroglobin at low pH--molecular mechanisms and biological significance.
19383366 2009 Expression and hypoxic up-regulation of neuroglobin in human glioblastoma cells.
19327369 2009 Neuroglobin and prion cellular localization: investigation of a potential interaction.
19307722 2009 Pseudo-merohedral twinning in monoclinic crystals of wild-type human brain neuroglobin.
19087291 2008 Association between Ngb polymorphisms and ischemic stroke in the Southern Chinese Han population.
19010568 2010 Neuroglobin and Alzheimer's dementia: genetic association and gene expression changes.
19001220 2008 Patterns of distribution of oxygen-binding globins, neuroglobin and cytoglobin in human retina.
18767815 2008 Identification of protein radicals formed in the human neuroglobin-H2O2 reaction using immuno-spin trapping and mass spectrometry.
18416560 2008 Zebrafish neuroglobin is a cell-membrane-penetrating globin.
18302932 2008 Neuroprotective function of human neuroglobin is correlated with its guanine nucleotide dissociation inhibitor activity.
17975837 2008 Exploring the molecular basis of heme coordination in human neuroglobin.
17600531 2007 Reactivity and endogenous modification by nitrite and hydrogen peroxide: does human neuroglobin act only as a scavenger?
17337004 2007 Molecular basis of guanine nucleotide dissociation inhibitor activity of human neuroglobin by chemical cross-linking and mass spectrometry.
17210637 2007 Identification and characterization of putative tumor suppressor NGB, a GTP-binding protein that interacts with the neurofibromatosis 2 protein.
16201751 2005 Structural characterization of the proximal and distal histidine environment of cytoglobin and neuroglobin.
15819897 2005 Hyperthermal stability of neuroglobin and cytoglobin.
15808606 Protection of islets in culture by delivery of oxygen binding neuroglobin via protein transduction.
15723537 2005 Identification of residues in human neuroglobin crucial for Guanine nucleotide dissociation inhibitor activity.
15598495 2005 Neuroglobin and cytoglobin in search of their role in the vertebrate globin family.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15488767 2004 Temperature dependence of NO binding modes in human neuroglobin.
15299006 2004 Allosteric regulation and temperature dependence of oxygen binding in human neuroglobin and cytoglobin. Molecular mechanisms and physiological significance.
15193759 2004 Neuron-specific expression of neuroglobin in mammals.
15122877 2004 Association of human neuroglobin with cystatin C, a cysteine proteinase inhibitor.
15036292 2004 Coupling of the heme and an internal disulfide bond in human neuroglobin.
14645216 2004 Residues in the distal heme pocket of neuroglobin. Implications for the multiple ligand binding steps.
14530264 2003 The redox state of the cell regulates the ligand binding affinity of human neuroglobin and cytoglobin.
12962627 2003 Human brain neuroglobin structure reveals a distinct mode of controlling oxygen affinity.
12958655 2003 [Identification of interaction and interaction domains between neuroglobin and Na(+), K(+)-ATPase beta2 subunit].
12860983 2003 Oxidized human neuroglobin acts as a heterotrimeric Galpha protein guanine nucleotide dissociation inhibitor.
12850561 2003 Localization of neuroglobin protein in the mouse brain.
12508121 2003 The DNA sequence and analysis of human chromosome 14.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12351835 2002 Human neuroglobin: crystals and preliminary X-ray diffraction analysis.
12239161 2002 Hemin induces neuroglobin expression in neural cells.
11820779 2002 Full-length cDNA cloning of human neuroglobin and tissue expression of rat neuroglobin.
11473128 2001 Biochemical characterization and ligand binding properties of neuroglobin, a novel member of the globin family.
11029004 2000 A vertebrate globin expressed in the brain.