Property Summary

NCBI Gene PubMed Count 38
PubMed Score 75.39
PubTator Score 32.49

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
astrocytic glioma 1.200 1.2e-02
dermatomyositis -1.100 2.9e-04
group 3 medulloblastoma 1.100 3.6e-02
intraductal papillary-mucinous carcinoma... 1.200 2.3e-02
intraductal papillary-mucinous neoplasm ... 1.100 1.3e-03
non primary Sjogren syndrome sicca 1.200 1.6e-02
osteosarcoma 1.029 8.6e-06
ovarian cancer 1.300 2.7e-04
psoriasis -3.200 6.4e-06
subependymal giant cell astrocytoma -1.042 2.0e-02

Protein-protein Interaction (5)

Gene RIF (19)

AA Sequence

MSTEGGFGGTSSSDAQQSLQSFWPRVMEEIRNLTVKDFRVQELPLARIKKIMKLDEDVKMISAEAPVLFA      1 - 70
KAAQIFITELTLRAWIHTEDNKRRTLQRNDIAMAITKFDQFDFLIDIVPRDELKPPKRQEEVRQSVTPAE     71 - 140
PVQYYFTLAQQPTAVQVQGQQQGQQTTSSTTTIQPGQIIIAQPQQGQTTPVTMQVGEGQQVQIVQAQPQG    141 - 210
QAQQAQSGTGQTMQVMQQIITNTGEIQQIPVQLNAGQLQYIRLAQPVSGTQVVQGQIQTLATNAQQGQRN    211 - 280
ASQGKPRRCLKETLQITQTEVQQGQQQFSQFTDGQRNSVQQARVSELTGEAEPREVKATGNSTPCTSSLP    281 - 350
TTHPPSHRAGASCVCCSQPQQSSTSPPPSDALQWVVVEVSGTPNQLETHRELHAPLPGMTSLSPLHPSQQ    351 - 420
LYQIQQVTMPAGQDLAQPMFIQSANQPSDGQAPQVTGD                                    421 - 458
//

Text Mined References (40)

PMID Year Title