Property Summary

NCBI Gene PubMed Count 54
PubMed Score 99.49
PubTator Score 51.04

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
malignant mesothelioma -1.200 1.1e-06
astrocytoma -1.300 5.6e-03
psoriasis -2.000 1.5e-04
osteosarcoma -1.399 3.8e-05
group 3 medulloblastoma 1.400 7.4e-03
atypical teratoid / rhabdoid tumor -1.200 2.1e-04
adult high grade glioma -1.100 1.6e-03
aldosterone-producing adenoma -1.244 1.7e-02
subependymal giant cell astrocytoma -1.338 4.9e-02
ovarian cancer -2.100 4.0e-07

Protein-protein Interaction (7)

Gene RIF (17)

PMID Text
26509926 Presence of NF-Y transcription factor plays a pivotal role in transcriptional regulation of ID genes in development.
26039627 NF-YB transcription factor was identified as a novel direct E2F1 target.
23595228 The NF-Y complex is asymmetric, with NF-YB binding approximately 15 bp downstream from the CCAAT motif.
23332751 The crystal structure of NF-Y bound to a 25 bp CCAAT oligonucleotide shows that the histone-fold domains dimer binds to the DNA sugar-phosphate backbone, mimicking the nucleosome H2A/H2B-DNA assembly; NF-YA both binds to NF-YB/NF-YC and inserts an alpha helix deeply into the DNA minor groove, providing sequence-specific contacts to the CCAAT box.
22132193 Transcriptional repression mediated by IER5 regulates Cdc25B expression levels via the release of NF-YB and p300 in acute myeloid leukemia.
21445285 NF-Y acts upstream of H3K4me3 deposition by recruiting Ash2L
21252292 MicroRNA-485-3p regulates drug responsiveness by decreasing nuclear factor-YB expression, which in turn negatively regulates DNA topoisomerase IIalpha.
20965718 Observational study of gene-disease association. (HuGE Navigator)
18480411 CBF-A is a novel transacting factor required for cytoplasmic mRNA transport and localization
18275041 trichostatin A activates the transcription of TSP1 gene through the binding of transcription factor CBF to CCAAT box and the enhanced histone acetylation.
15847654 Observational study of genetic testing. (HuGE Navigator)
15462673 Co-operative functional interactions between Sp1 & NF-Y are required to direct the activity of the ATP1A3 promoter predominantly in neuronal cells.
15044452 p53 negatively regulates Chk2 gene transcription through modulation of NF-Y function and that this regulation may be important for reentry of cells into the cell cycle after DNA damage is repaired.
14586402 Histone deacetylase inhibitors can induce Gadd45 through its promoter without the need for functional p53, and both Oct-1 and NF-Y concertedly participate in trichostatin A-induced activation of the gadd45 promoter.
12805369 CBF/NF-Y proteins regulate the transcription of COL11A1 by directly binding to the ATTGG sequence in the proximal promoter region
12482752 p300 binds to multiple NF-Y trimers to regulate cyclin B2 promoter function
12401788 The NF-YB/NF-YC structure gives insight into DNA binding and transcription regulation by CCAAT factor NF-Y.

AA Sequence

MTMDGDSSTTDASQLGISADYIGGSHYVIQPHDDTEDSMNDHEDTNGSKESFREQDIYLPIANVARIMKN      1 - 70
AIPQTGKIAKDAKECVQECVSEFISFITSEASERCHQEKRKTINGEDILFAMSTLGFDSYVEPLKLYLQK     71 - 140
FREAMKGEKGIGGAVTATDGLSEELTEEAFTNQLPAGLITTDGQQQNVMVYTTSYQQISGVQQIQFS       141 - 207
//

Text Mined References (56)

PMID Year Title
26509926 2015 Epigenetic role of CCAAT box-binding transcription factor NF-Y on ID gene family in human embryonic carcinoma cells.
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
26039627 2015 E2F1-Mediated Induction of NFYB Attenuates Apoptosis via Joint Regulation of a Pro-Survival Transcriptional Program.
25416956 2014 A proteome-scale map of the human interactome network.
25343990 2015 Genome-wide association study of selenium concentrations.
23734815 2013 Fludarabine treatment favors the retention of miR-485-3p by prostate cancer cells: implications for survival.
23595228 2013 NF-Y coassociates with FOS at promoters, enhancers, repetitive elements, and inactive chromatin regions, and is stereo-positioned with growth-controlling transcription factors.
23332751 2013 Sequence-specific transcription factor NF-Y displays histone-like DNA binding and H2B-like ubiquitination.
22132193 2011 Transcriptional repression of Cdc25B by IER5 inhibits the proliferation of leukemic progenitor cells through NF-YB and p300 in acute myeloid leukemia.
21988832 2011 Toward an understanding of the protein interaction network of the human liver.
21445285 2011 NF-Y recruits Ash2L to impart H3K4 trimethylation on CCAAT promoters.
21269460 2011 Initial characterization of the human central proteome.
21252292 2011 Novel regulation of nuclear factor-YB by miR-485-3p affects the expression of DNA topoisomerase II? and drug responsiveness.
20965718 2011 Genetic variability of the fatty acid synthase pathway is not associated with prostate cancer risk in the European Prospective Investigation on Cancer (EPIC).
20936779 2010 A human MAP kinase interactome.
19223331 2009 HMGB1 and HMGB2 proteins up-regulate cellular expression of human topoisomerase IIalpha.
18480411 2008 In cultured oligodendrocytes the A/B-type hnRNP CBF-A accompanies MBP mRNA bound to mRNA trafficking sequences.
18275041 2008 CCAAT box is required for the induction of human thrombospondin-1 gene by trichostatin A.
16959611 2006 Gain of function of mutant p53: the mutant p53/NF-Y protein complex reveals an aberrant transcriptional mechanism of cell cycle regulation.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15964792 2005 Subunits of the heterotrimeric transcription factor NF-Y are imported into the nucleus by distinct pathways involving importin beta and importin 13.
15847654 2005 A flexible array format for large-scale, rapid blood group DNA typing.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15462673 2005 The expression of the human neuronal alpha3 Na+,K+-ATPase subunit gene is regulated by the activity of the Sp1 and NF-Y transcription factors.
15243141 2004 Human p32, interacts with B subunit of the CCAAT-binding factor, CBF/NF-Y, and inhibits CBF-mediated transcription activation in vitro.
15044452 2004 Negative regulation of Chk2 expression by p53 is dependent on the CCAAT-binding transcription factor NF-Y.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14586402 2003 p53-independent induction of Gadd45 by histone deacetylase inhibitor: coordinate regulation by transcription factors Oct-1 and NF-Y.
12805369 2003 The transcription factor CCAAT-binding factor CBF/NF-Y regulates the proximal promoter activity in the human alpha 1(XI) collagen gene (COL11A1).
12766061 2003 Gene expression profile of the human trabecular meshwork: NEIBank sequence tag analysis.
12482752 2003 Interactions between p300 and multiple NF-Y trimers govern cyclin B2 promoter function.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12401788 2003 The NF-YB/NF-YC structure gives insight into DNA binding and transcription regulation by CCAAT factor NF-Y.
12167641 2002 p73 independent of c-Myc represses transcription of platelet-derived growth factor beta-receptor through interaction with NF-Y.
11306579 2001 HSP-CBF is an NF-Y-dependent coactivator of the heat shock promoters CCAAT boxes.
11282029 2001 Mechanism for the transcriptional repression by c-Myc on PDGF beta-receptor.
11256944 2001 Identification of the G13 (cAMP-response-element-binding protein-related protein) gene product related to activating transcription factor 6 as a transcriptional activator of the mammalian unfolded protein response.
11022037 2001 Functional interaction of NF-Y and Sp1 is required for type a natriuretic peptide receptor gene transcription.
11003667 2000 CIITA leucine-rich repeats control nuclear localization, in vivo recruitment to the major histocompatibility complex (MHC) class II enhanceosome, and MHC class II gene transactivation.
10571030 1999 The molecular biology of the CCAAT-binding factor NF-Y.
10075648 1999 The B subunit of the CAAT-binding factor NFY binds the central segment of the Co-activator p300.
9668064 1998 Purification and characterization of a protein binding to the SP6 kappa promoter. A potential role for CArG-box binding factor-A in kappa transcription.
9660784 1998 Biochemical characterization of the NF-Y transcription factor complex during B lymphocyte development.
9612081 1998 Role of the CCAAT-binding protein CBF/NF-Y in transcription.
9442396 1997 Repression mechanisms of the I-A beta gene of the major histocompatibility complex.
9430679 1998 NF-Y is associated with the histone acetyltransferases GCN5 and P/CAF.
9388234 1997 Functional interaction between the DNA binding subunit trimerization domain of NF-Y and the high mobility group protein HMG-I(Y).
9153318 1997 CCAAT binding NF-Y-TBP interactions: NF-YB and NF-YC require short domains adjacent to their histone fold motifs for association with TBP basic residues.
9032250 1997 Physical and functional interaction between the human T-cell lymphotropic virus type 1 Tax1 protein and the CCAAT binding protein NF-Y.
8051128 1994 Dominant negative analogs of NF-YA.
8027044 1994 Human thymidine kinase CCAAT-binding protein is NF-Y, whose A subunit expression is serum-dependent in human IMR-90 diploid fibroblasts.
7651426 1995 Repression of major histocompatibility complex I-A beta gene expression by dbpA and dbpB (mYB-1) proteins.
1774067 1991 One subunit of the transcription factor NF-Y maps close to the major histocompatibility complex in murine and human chromosomes.
1577736 1992 Intron-exon organization of the NF-Y genes. Tissue-specific splicing modifies an activation domain.
1549471 1992 Evolutionary variation of the CCAAT-binding transcription factor NF-Y.