Property Summary

NCBI Gene PubMed Count 77
PubMed Score 102.72
PubTator Score 81.99

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Disease log2 FC p
urothelial carcinoma 1.200 2.4e-02
malignant mesothelioma 1.500 4.5e-07
psoriasis -1.200 9.4e-04
osteosarcoma 1.745 2.3e-03
atypical teratoid / rhabdoid tumor 1.500 3.2e-06
glioblastoma 1.500 3.3e-05
medulloblastoma 1.500 3.3e-03
medulloblastoma, large-cell 1.600 4.4e-04
intraductal papillary-mucinous adenoma (... 1.200 2.0e-04
lung cancer 1.500 6.5e-03
colon cancer 1.400 9.0e-04
active ulcerative colitis -1.347 8.9e-03
cystic fibrosis -1.300 4.3e-05
adult high grade glioma -1.200 1.4e-03
pilocytic astrocytoma -1.300 6.5e-06
ductal carcinoma in situ 1.300 9.7e-05
invasive ductal carcinoma 1.300 8.2e-03

Gene RIF (47)

PMID Text
26921500 our results indicate that NF-YA alternative splicing is an influential muscle cell determinant, through direct regulation of selected cell cycle blocking genes, and, directly and indirectly, of muscle-specific transcription factors
26732297 A direct non-transcriptional role of NF-Y in the overall efficiency of DNA replication, specifically in the DNA elongation process.
26509926 Presence of NF-Y transcription factor plays a pivotal role in transcriptional regulation of ID genes in development.
26170459 enhanced CDCA8 promoter activities by NF-Y overexpression and reduced CDCA8 transcription by NF-Y knockdown further verified that NF-Y is a positive regulator of CDCA8 transcription.
25756534 NF-Y inhibits NT2/D1 cell growth in p53-independent manner and decreases SOX2 expression.
25473899 Data show that Zinc-fingers and homeoboxes 2 (ZHX2) represses nuclear transcription factor Y alpha (NF-Y)-mediated activation of multidrug resistance 1 (MDR1) transcription.
25463392 Stimulation of the lymphocytes with phytohemagglutinin, restores normal OGG1 levels and repair rates. MAP kinase c-Jun N-terminal kinase (JNK) and the recruitment of the transcription factor NFYA to the promoter region of OGG1 are shown to be involved.
24407240 Association of p21 with NF-YA suppresses the expression of PLK1 and prevents mitotic death in response to DNA damage.
23595228 NF-YA binds directly over the CCAAT sequence.
23332751 The crystal structure of NF-Y bound to a 25 bp CCAAT oligonucleotide shows that the histone-fold domains dimer binds to the DNA sugar-phosphate backbone, mimicking the nucleosome H2A/H2B-DNA assembly; NF-YA both binds to NF-YB/NF-YC and inserts an alpha helix deeply into the DNA minor groove, providing sequence-specific contacts to the CCAAT box.
23071749 NF-Y recruits the developmentally regulated, erythroid transcription activator GATA-2 and general repressor BCL11A to modulate transcription of the gamma-globin gene.
22944692 Positional proteomics analysis identifies the cleavage of human nuclear transcription factor Y, alpha (NFYA) at amino acid residues 238-239 by the HIV-1 protease
22530004 NFYA could be a target of mutant TBP in SCA17.
22383952 Sp1, CREB, HNF-1, and NF-Y, known to be responsive to hormones and diet, regulate NAGS transcription
22285817 This study unveils a new role for NF-Y in the regulation of human proteasome genes.
20965718 Observational study of gene-disease association. (HuGE Navigator)
20952509 Findings establish that NF-Y acts upstream of E2F1 in p53-mediated apoptosis.
20630860 A novel mechanism involving coordinated regulation of nuclear levels and acetylation of NF-YA and Bcl6 activates RGS4 transcription.
20023394 The phospho-DeltaNp63alpha forms protein-protein complexes with NF-YA transcription factor regulate the transcription of DDIT3 gene implicated in the programmed cell death of head and neck squamous cell carcinoma cells upon cisplatin exposure.
19828605 the immediate-early ICP0 gene may be among the first genes to be induced during the early events in HSV-1 reactivation, and NF-Y is important for this induction, and other factors induce the ICP22 promoter.
19351437 review: role of the C/EBPbeta isoforms in breast cancer
19302979 O-GlcNAc of Sp1 serine/threonine-rich region interrupts a physical interaction between Sp1 and NF-YA, thus inhibiting Sp1-NF-Y cooperative activation of gene transcription.
18654640 Genome-wide occupancy of SREBP1 and its partners NFY and SP1 reveals novel functional roles and combinatorial regulation of distinct classes of genes.
18541673 The existence of a functional binding site for the tumor suppressor p53 near the proximal CCAAT box and the fact that the basal expression of annexin A1 in human colon adenocarcinoma cells is driven by p53 at the transcriptional level, is shown.
18496767 Transcription factors Sp3, ZBP-89 and NF-Y are capable of binding to the SOX18 promoter region.
18446193 NF-Y is a fundamental switch at the heart of decision between gene activation and repression in CCAAT regulated genes.
18372207 p53 overexpression strongly downregulates the transcriptional efficiency driven by an H ferritin promoter construct containing only the NF-Y recognition sequence.
18281530 NF-Y is an important mediator of EBV stress response in switching from a latent to lytic state
17910945 Our data indicate that multiple CCAAT control elements are involved in the regulation of the SOX3 promoter, suggesting that NF-Y functions as a key regulator of SOX3 gene expression.
17289878 cyclin B2 expression in colorectal adenocarcinoma is dependent on NF-Y
16343534 Data suggest that the cell specifity of HIV-1 expression and replication may be regulated, in part, through the control of TRBP1 expression by NF-Y factors.
16081537 NF-Ya is a potent cellular regulator of hematopoietic stem cell self-renewal
15847654 Observational study of genetic testing. (HuGE Navigator)
15707954 These results indicate that 1,25(OH)2D3 may affect transcription of the human PTH gene both by competitive binding of VDR and NF-Y, and by modulating transcriptional activity of NF-Y.
15647279 transforming growth factor beta type II receptor promoter activity and acetylation of Sp1 by recruitment of PCAF/p300 to a Sp1.NF-Y complex are induced by Trichostatin A
15150264 NF-Y has a role in regulating EPHX1 expression through its interaction with C/EBPalpha
15044452 p53 negatively regulates Chk2 gene transcription through modulation of NF-Y function and that this regulation may be important for reentry of cells into the cell cycle after DNA damage is repaired.
14688259 NF-YA has a role in regulating the induction of human OGG1 following administration of DNA-alkylating agents
14586402 Histone deacetylase inhibitors can induce Gadd45 through its promoter without the need for functional p53, and both Oct-1 and NF-Y concertedly participate in trichostatin A-induced activation of the gadd45 promoter.
12857729 NF-YA is phosphorylated in a pathway involving Cdk2
12791656 NF-Y is a developmentally regulated inducer of the HOXB4 gene in hematopoietic cells.
12511565 role in inhibiting von Willebrand factor promoter activation through recruitment of histone deacetylases
12482752 p300 binds to multiple NF-Y trimers to regulate cyclin B2 promoter function
12427542 confirms the important transactivating role of NF-YA isoforms for the cystathionine beta synthase 1b promoter via its synergism with Sp1
12392713 NF-YA increases during CaCo-2 differentiation and that the constitutive expression of NF-YA, obtained in stably transfected CaCo-2 cells, results in the expression of differentiation markers
11777930 immunodepletion of Oct-1 and NF-YA proteins or mutations in the OCT-1 and CAAT motifs disrupt BRCA1 binding to the GADD45 promoter
3476205 NF-Y (complex of NFYA, NFYB, and NFYC) was initially described as the factor binding to the Y box of MHC class II genes, an essential element of MHC class II gene enhancers and promoters.

AA Sequence

MEQYTANSNSSTEQIVVQAGQIQQQQQGGVTAVQLQTEAQVASASGQQVQTLQVVQGQPLMVQVSGGQLI      1 - 70
TSTGQPIMVQAVPGGQGQTIMQVPVSGTQGLQQIQLVPPGQIQIQGGQAVQVQGQQGQTQQIIIQQPQTA     71 - 140
VTAGQTQTQQQIAVQGQQVAQTAEGQTIVYQPVNADGTILQQVTVPVSGMITIPAASLAGAQIVQTGANT    141 - 210
NTTSSGQGTVTVTLPVAGNVVNSGGMVMMVPGAGSVPAIQRIPLPGAEMLEEEPLYVNAKQYHRILKRRQ    211 - 280
ARAKLEAEGKIPKERRKYLHESRHRHAMARKRGEGGRFFSPKEKDSPHMQDPNQADEEAMTQIIRVS       281 - 347
//

Text Mined References (80)

PMID Year Title
26921500 2016 NF-YA splice variants have different roles on muscle differentiation.
26732297 2016 Direct non transcriptional role of NF-Y in DNA replication.
26509926 2015 Epigenetic role of CCAAT box-binding transcription factor NF-Y on ID gene family in human embryonic carcinoma cells.
26170459 2015 Transcriptional activation of human CDCA8 gene regulated by transcription factor NF-Y in embryonic stem cells and cancer cells.
25756534 2015 Transcription factor NF-Y inhibits cell growth and decreases SOX2 expression in human embryonal carcinoma cell line NT2/D1.
25473899 2015 ZHX2 enhances the cytotoxicity of chemotherapeutic drugs in liver tumor cells by repressing MDR1 via interfering with NF-YA.
25463392 2015 The repair of oxidized purines in the DNA of human lymphocytes requires an activation involving NF-YA-mediated upregulation of OGG1.
25416956 2014 A proteome-scale map of the human interactome network.
24407240 2014 Association of p21 with NF-YA suppresses the expression of Polo-like kinase 1 and prevents mitotic death in response to DNA damage.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23595228 2013 NF-Y coassociates with FOS at promoters, enhancers, repetitive elements, and inactive chromatin regions, and is stereo-positioned with growth-controlling transcription factors.
23332751 2013 Sequence-specific transcription factor NF-Y displays histone-like DNA binding and H2B-like ubiquitination.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23071749 2012 NF-Y recruits both transcription activator and repressor to modulate tissue- and developmental stage-specific expression of human ?-globin gene.
22530004 2012 Role of the CCAAT-binding protein NFY in SCA17 pathogenesis.
22383952 2012 Transcriptional regulation of N-acetylglutamate synthase.
22285817 2012 The CCAAT box-binding transcription factor NF-Y regulates basal expression of human proteasome genes.
20965718 2011 Genetic variability of the fatty acid synthase pathway is not associated with prostate cancer risk in the European Prospective Investigation on Cancer (EPIC).
20952509 2010 Transcription factor NF-Y induces apoptosis in cells expressing wild-type p53 through E2F1 upregulation and p53 activation.
20936779 2010 A human MAP kinase interactome.
20630860 2010 A novel mechanism involving coordinated regulation of nuclear levels and acetylation of NF-YA and Bcl6 activates RGS4 transcription.
20023394 2010 Phospho-DeltaNp63alpha/NF-Y protein complex transcriptionally regulates DDIT3 expression in squamous cell carcinoma cells upon cisplatin exposure.
19828605 2010 Role of nuclear factor Y in stress-induced activation of the herpes simplex virus type 1 ICP0 promoter.
19351437 2009 CCAAT/enhancer-binding protein beta: its role in breast cancer and associations with receptor tyrosine kinases.
19302979 2009 O-GlcNAcylation of Sp1 interrupts Sp1 interaction with NF-Y.
19060904 2009 An empirical framework for binary interactome mapping.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18654640 2008 Genome-wide occupancy of SREBP1 and its partners NFY and SP1 reveals novel functional roles and combinatorial regulation of distinct classes of genes.
18541673 2008 Upregulation of annexin A1 expression by butyrate in human colon adenocarcinoma cells: role of p53, NF-Y, and p38 mitogen-activated protein kinase.
18496767 2009 ZBP-89 and Sp3 down-regulate while NF-Y up-regulates SOX18 promoter activity in HeLa cells.
18446193 2008 An NF-Y-dependent switch of positive and negative histone methyl marks on CCAAT promoters.
18372207 2008 p53-mediated downregulation of H ferritin promoter transcriptional efficiency via NF-Y.
18281530 2008 Nuclear factor-Y and Epstein Barr virus in nasopharyngeal cancer.
17910945 2007 Regulation of SOX3 gene expression is driven by multiple NF-Y binding elements.
17289878 2007 NF-Y-dependent cyclin B2 expression in colorectal adenocarcinoma.
16959611 2006 Gain of function of mutant p53: the mutant p53/NF-Y protein complex reveals an aberrant transcriptional mechanism of cell cycle regulation.
16343534 2006 Cell-specific regulation of TRBP1 promoter by NF-Y transcription factor in lymphocytes and astrocytes.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
16081537 2005 NF-Ya activates multiple hematopoietic stem cell (HSC) regulatory genes and promotes HSC self-renewal.
15964792 2005 Subunits of the heterotrimeric transcription factor NF-Y are imported into the nucleus by distinct pathways involving importin beta and importin 13.
15847654 2005 A flexible array format for large-scale, rapid blood group DNA typing.
15707954 2005 Negative regulation of human parathyroid hormone gene promoter by vitamin D3 through nuclear factor Y.
15647279 2005 Trichostatin A induces transforming growth factor beta type II receptor promoter activity and acetylation of Sp1 by recruitment of PCAF/p300 to a Sp1.NF-Y complex.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15243141 2004 Human p32, interacts with B subunit of the CCAAT-binding factor, CBF/NF-Y, and inhibits CBF-mediated transcription activation in vitro.
15150264 2004 CCAAT/enhancer-binding protein alpha (C/EBPalpha) activates transcription of the human microsomal epoxide hydrolase gene (EPHX1) through the interaction with DNA-bound NF-Y.
15044452 2004 Negative regulation of Chk2 expression by p53 is dependent on the CCAAT-binding transcription factor NF-Y.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14688259 2004 Transcription factors NF-YA regulate the induction of human OGG1 following DNA-alkylating agent methylmethane sulfonate (MMS) treatment.
14586402 2003 p53-independent induction of Gadd45 by histone deacetylase inhibitor: coordinate regulation by transcription factors Oct-1 and NF-Y.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12909359 2003 Three CCAAT-boxes and a single cell cycle genes homology region (CHR) are the major regulating sites for transcription from the human cyclin B2 promoter.
12857729 2003 Cdk2-dependent phosphorylation of the NF-Y transcription factor and its involvement in the p53-p21 signaling pathway.
12791656 2003 NF-Y cooperates with USF1/2 to induce the hematopoietic expression of HOXB4.
12741956 2003 Zinc-fingers and homeoboxes (ZHX) 2, a novel member of the ZHX family, functions as a transcriptional repressor.
12730328 2003 Nuclear factor Y and steroidogenic factor 1 physically and functionally interact to contribute to cell-specific expression of the mouse Follicle-stimulating hormone-beta gene.
12659632 2003 Analysis of zinc-fingers and homeoboxes (ZHX)-1-interacting proteins: molecular cloning and characterization of a member of the ZHX family, ZHX3.
12511565 2003 The NFY transcription factor inhibits von Willebrand factor promoter activation in non-endothelial cells through recruitment of histone deacetylases.
12482752 2003 Interactions between p300 and multiple NF-Y trimers govern cyclin B2 promoter function.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12427542 2002 Synergistic regulation of human cystathionine-beta-synthase-1b promoter by transcription factors NF-YA isoforms and Sp1.
12392713 2002 Transcription factor NF-Y regulates differentiation of CaCo-2 cells.
11903046 2002 An alternative model of H ferritin promoter transactivation by c-Jun.
11777930 2002 BRCA1 regulates GADD45 through its interactions with the OCT-1 and CAAT motifs.
11256944 2001 Identification of the G13 (cAMP-response-element-binding protein-related protein) gene product related to activating transcription factor 6 as a transcriptional activator of the mammalian unfolded protein response.
10571058 1999 Identification of proteins that interact with NF-YA.
10571030 1999 The molecular biology of the CCAAT-binding factor NF-Y.
10441475 1999 Human ZHX1: cloning, chromosomal location, and interaction with transcription factor NF-Y.
10393239 1999 Interaction between the two ubiquitously expressed transcription factors NF-Y and Sp1.
9660784 1998 Biochemical characterization of the NF-Y transcription factor complex during B lymphocyte development.
9612081 1998 Role of the CCAAT-binding protein CBF/NF-Y in transcription.
9388234 1997 Functional interaction between the DNA binding subunit trimerization domain of NF-Y and the high mobility group protein HMG-I(Y).
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
8051128 1994 Dominant negative analogs of NF-YA.
3476205 1987 A multiplicity of CCAAT box-binding proteins.
2266139 1990 Purification and molecular cloning of the "A" chain of a rat heteromeric CCAAT-binding protein. Sequence identity with the yeast HAP3 transcription factor.
2000400 1991 A cDNA encoding a human CCAAT-binding protein cloned by functional complementation in yeast.
1774067 1991 One subunit of the transcription factor NF-Y maps close to the major histocompatibility complex in murine and human chromosomes.
1577736 1992 Intron-exon organization of the NF-Y genes. Tissue-specific splicing modifies an activation domain.
1549471 1992 Evolutionary variation of the CCAAT-binding transcription factor NF-Y.