Property Summary

NCBI Gene PubMed Count 31
PubMed Score 113.34
PubTator Score 61.10

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (26)

Disease log2 FC p
Rheumatoid Arthritis 2.800 1.5e-04
osteosarcoma 3.155 8.7e-06
cystic fibrosis 2.100 2.9e-03
glioblastoma 1.600 1.5e-03
medulloblastoma, large-cell -1.200 1.6e-02
autosomal dominant Emery-Dreifuss muscul... 1.316 1.4e-02
juvenile dermatomyositis 1.166 5.1e-06
acute quadriplegic myopathy 1.056 8.5e-03
adrenocortical carcinoma -1.607 1.1e-02
primary pancreatic ductal adenocarcinoma 2.271 1.0e-04
non-small cell lung cancer -1.943 1.5e-15
active Crohn's disease 1.642 1.5e-02
interstitial cystitis 1.400 3.1e-03
atypical teratoid/rhabdoid tumor -1.200 2.5e-03
pilocytic astrocytoma 1.400 5.0e-04
posterior fossa group A ependymoma 1.300 5.2e-03
sonic hedgehog group medulloblastoma -1.100 2.4e-02
psoriasis 2.100 1.1e-190
subependymal giant cell astrocytoma 2.650 9.0e-03
lung carcinoma -3.300 1.0e-25
spina bifida -1.709 3.9e-02
acute myeloid leukemia 1.200 3.2e-02
ulcerative colitis 2.300 4.1e-07
ovarian cancer -3.100 4.2e-07
pituitary cancer -2.400 2.5e-04
pancreatic cancer 2.100 4.6e-04

 GWAS Trait (1)

Gene RIF (24)

PMID Text
26711529 These results indicate that the LPS/IL-1beta-MyD88 axis plays a crucial role for stabilization of IkappaB-zeta mRNA.
26398661 We propose a previously unappreciated role of IkappaBzeta in the inflammatory micromilieu as well as progression in glioma
25629767 NFKBIZ gene knockdown in bronchial epithelial cells suppresses the release of IL-1b-induced IL-6 and GMCSF.
25474109 Interferon-gamma (IFN-gamma) interferes with the IL-1/IKB-zeta axis in beta-glucan-activated dendritic cells and promotes T cell-mediated immune responses with increased release of IFN-gamma and IL-22.
24667918 Microarray analysis indicates HIV-1 Tat-induced upregulation of nuclear factor of kappa light polypeptide gene enhancer in B-cells inhibitor, zeta (NFKBIZ) in primary human brain microvascular endothelial cells
24027435 NF-kappaB-binding cofactor inhibitor of NF-kappaB-zeta (IkappaB-zeta) is constitutively expressed in HTLV-I-infected T cell lines and ATL cells, and Tax transactivates the IkappaB-zeta gene, mainly through NF-kappaB.
23898208 Microarray analysis indicates HIV-1 Tat-induced upregulation of nuclear factor of kappa light polypeptide gene enhancer in B-cells inhibitor, zeta (NFKBIZ) in primary human brain microvascular endothelial cells
23869088 our data demonstrate that IkappaB-zeta is essential for nuclear NF-kappaB activity in activated B-cell-like subtype of diffuse large B-cell lymphoma
22059479 investigation of signaling components that induce activation of post-transcriptional mechanism for IkappaB-zeta induction/activation: Activation of IRAK1 or IRAK4, but not TRAF6, is sufficient.
21224476 IkappaBzeta functions as an important regulator of IFN-gamma in human NK cells
20650996 analysis of the sequence of flagellin/TLR5- and type IV-dependent IkappaBzeta expression, recruitment of IkappaBzeta/p50 to the il6 promoter, chromatin remodelling and subsequent IL-6 transcription in L. pneumophila-infected lung epithelial cells
19798075 conclude that multiple NFKBIZ polymorphisms associate with susceptibility to IPD in humans. The study of multiple populations may aid in fine mapping of associations within extensive regions of strong linkage disequilibrium
19783680 MAIL is a key regulator of IL-6 production in human monocytes and plays an important role in both TLR and NOD-like receptor ligand induced inflammation.
19707556 silencing of IkappaBzeta expression led to a specific decrease in IFNgamma production. Overall, our data suggests that IkappaBzeta positively regulates NFkappaB-mediated IFNgamma production in KG-1 cells
19595668 These results suggest that IkappaB-zeta is a negative regulator of STAT3, and demonstrate a novel mechanism in which a component of the NF-kappaB signaling pathway inhibits the activation of STAT3.
18850010 The nuclear factor NFKBIZ colocalizes with FUS-DDIT3 in nuclear structures. FUS-DDIT3 binds the C-terminal of NFKBIZ. FUS-DDIT3 deregulates some NF-kappaB-controlled genes through interactions with NFKBIZ.
18813073 Observational study of gene-disease association. (HuGE Navigator)
18436238 I kappaB zeta binds preferentially to NF-kappaB p50 homodimers.
18362142 the NF-kappaB binding cofactor, IkappaB-zeta, was up-regulated by IL-17A, and the knockdown of IkappaB-zeta significantly diminished the IL-17A-induced hBD-2 expression.
17447895 IkappaB-zeta acts as an essential transcriptional activator by forming a complex with NF-kappaB on promoters harbouring the NF-kappaB- and C/EBP-binding sites.
16622025 IL-1beta specificity is caused by a requirement of the neutrophil gelatinase-associated lipocalin promoter for the NF-kappaB-binding cofactor IkappaB-zeta for transcriptional activation
16513645 IkappaB-zeta functions as an additional regulator of NF-kappaB activity
15618216 IkappaB-zeta harbors latent transcriptional activation activity which is expressed upon interaction with the NF-kappaB p50 subunit
12565889 These results indicate the existence of another signal essential for I kappa B-zeta induction, which is specifically mediated by the Toll/interleukin-1 receptor (TIR) domain-mediated signaling pathway.

AA Sequence

MIVDKLLDDSRGGEGLRDAAGGCGLMTSPLNLSYFYGASPPAAAPGACDASCSVLGPSAPGSPGSDSSDF      1 - 70
SSASSVSSCGAVESRSRGGARAERQPVEPHMGVGRQQRGPFQGVRVKNSVKELLLHIRSHKQKASGQAVD     71 - 140
DFKTQGVNIEQFRELKNTVSYSGKRKGPDSLSDGPACKRPALLHSQFLTPPQTPTPGESMEDVHLNEPKQ    141 - 210
ESSADLLQNIINIKNECSPVSLNTVQVSWLNPVVVPQSSPAEQCQDFHGGQVFSPPQKCQPFQVRGSQQM    211 - 280
IDQASLYQYSPQNQHVEQQPHYTHKPTLEYSPFPIPPQSPAYEPNLFDGPESQFCPNQSLVSLLGDQRES    281 - 350
ENIANPMQTSSSVQQQNDAHLHSFSMMPSSACEAMVGHEMASDSSNTSLPFSNMGNPMNTTQLGKSLFQW    351 - 420
QVEQEESKLANISQDQFLSKDADGDTFLHIAVAQGRRALSYVLARKMNALHMLDIKEHNGQSAFQVAVAA    421 - 490
NQHLIVQDLVNIGAQVNTTDCWGRTPLHVCAEKGHSQVLQAIQKGAVGSNQFVDLEATNYDGLTPLHCAV    491 - 560
IAHNAVVHELQRNQQPHSPEVQELLLKNKSLVDTIKCLIQMGAAVEAKDRKSGRTALHLAAEEANLELIR    561 - 630
LFLELPSCLSFVNAKAYNGNTALHVAASLQYRLTQLDAVRLLMRKGADPSTRNLENEQPVHLVPDGPVGE    631 - 700
QIRRILKGKSIQQRAPPY                                                        701 - 718
//

Text Mined References (33)

PMID Year Title
26711529 2016 Screening of posttranscriptional regulatory molecules of I?B-?.
26398661 2015 I?B?, an atypical member of the inhibitor of nuclear factor kappa B family, is induced by ?-irradiation in glioma cells, regulating cytokine secretion and associated with poor prognosis.
25629767 2015 House Dust Mite Allergens and the Induction of Monocyte Interleukin 1? Production That Triggers an I?B?-Dependent Granulocyte Macrophage Colony-Stimulating Factor Release from Human Lung Epithelial Cells.
25474109 2014 Interleukin-1 and interferon-? orchestrate ?-glucan-activated human dendritic cell programming via I?B-? modulation.
25107474 2014 Akirin2 is critical for inducing inflammatory genes by bridging I?B-? and the SWI/SNF complex.
24027435 2013 Human T cell leukemia virus type I tax-induced I?B-? modulates tax-dependent and tax-independent gene expression in T cells.
23869088 2013 I?B-? controls the constitutive NF-?B target gene network and survival of ABC DLBCL.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22059479 2012 Identification of interleukin-1 receptor-associated kinase 1 as a critical component that induces post-transcriptional activation of I?B-?.
21833088 2011 Genetic risk and a primary role for cell-mediated immune mechanisms in multiple sclerosis.
21224476 2011 I?B? augments IL-12- and IL-18-mediated IFN-? production in human NK cells.
20650996 2011 Legionella pneumophila-induced I?B?-dependent expression of interleukin-6 in lung epithelium.
19798075 2010 NFKBIZ polymorphisms and susceptibility to pneumococcal disease in European and African populations.
19783680 2009 MAIL regulates human monocyte IL-6 production.
19707556 2009 A novel role for IkappaBzeta in the regulation of IFNgamma production.
19595668 2009 Nuclear protein IkappaB-zeta inhibits the activity of STAT3.
18850010 2009 The myxoid liposarcoma FUS-DDIT3 fusion oncoprotein deregulates NF-kappaB target genes by interaction with NFKBIZ.
18813073 2008 Innate immunity of the ocular surface and ocular surface inflammatory disorders.
18436238 2008 The nuclear I kappaB protein I kappaB zeta specifically binds NF-kappaB p50 homodimers and forms a ternary complex on kappaB DNA.
18362142 2008 Requirements for two proximal NF-kappaB binding sites and IkappaB-zeta in IL-17A-induced human beta-defensin 2 expression by conducting airway epithelium.
17447895 2007 Crucial roles of binding sites for NF-kappaB and C/EBPs in IkappaB-zeta-mediated transcriptional activation.
16622025 2006 IL-1beta-specific up-regulation of neutrophil gelatinase-associated lipocalin is controlled by IkappaB-zeta.
16513645 2006 A novel member of the IkappaB family, human IkappaB-zeta, inhibits transactivation of p65 and its DNA binding.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15618216 2005 Positive and negative regulation of nuclear factor-kappaB-mediated transcription by IkappaB-zeta, an inducible nuclear protein.
15522867 2005 Stimulus-specific induction of a novel nuclear factor-kappaB regulator, IkappaB-zeta, via Toll/Interleukin-1 receptor is mediated by mRNA stabilization.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15241416 2004 Regulation of Toll/IL-1-receptor-mediated gene expression by the inducible nuclear protein IkappaBzeta.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12565889 2003 Essential roles for NF-kappa B and a Toll/IL-1 receptor domain-specific signal(s) in the induction of I kappa B-zeta.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11356851 2001 A novel IkappaB protein, IkappaB-zeta, induced by proinflammatory stimuli, negatively regulates nuclear factor-kappaB in the nuclei.
11278262 2001 Isolation of a novel interleukin-1-inducible nuclear protein bearing ankyrin-repeat motifs.