Property Summary

NCBI Gene PubMed Count 50
PubMed Score 28.22
PubTator Score 42.91

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
non primary Sjogren syndrome sicca 840 1.5e-02
Disease Target Count
Rheumatoid Arthritis 1170

Expression

  Differential Expression (1)

Disease log2 FC p
non primary Sjogren syndrome sicca 1.200 1.5e-02

Gene RIF (45)

PMID Text
25809685 genetic association studies in a population of black women in South Africa: Data suggest that an SNP in NFKBIL1 (rs2071592) is associated with iron status/iron-deficiency anemia in the population studied.
23953137 These observations suggest a functional involvement of IkappaBL in the regulation of alternative splicing in both human and viral genes, which is a novel link of HLA locus to the regulation of immunity and infection in humans.
22210660 an association was noted between IKBL-62T and idiopathic inflammatory myopathy, with increased risk noted in anti-Jo-1- and -PM-Scl antibody-positive patients; the IKBL-62T association is dependent on TNF-308A and HLA-B*08, due to strong shared linkage disequilibrium between these alleles
20933106 Observational study of gene-disease association. (HuGE Navigator)
20854863 Observational study of gene-disease association. (HuGE Navigator)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20587610 Observational study of gene-disease association. (HuGE Navigator)
20568399 Results of the present study do not provide evidence for the association between the NFKBIL1 exon 4 polymorphism and MS predisposition in the investigated Polish population.
20568399 Observational study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19886988 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19851445 Observational study of gene-disease association. (HuGE Navigator)
19773279 Observational study of gene-disease association. (HuGE Navigator)
19578685 results do not provide evidence for the association between the -62A/T NFKBIL1 polymorphism and obsessive-compulsive disorder in this Brazilian sample.
19242354 Observational study of gene-disease association. (HuGE Navigator)
19165231 The DPB1 gene controlled the severity of the vascular lesion, whereas the IKBL gene (NFKBIL1) was associated with a relatively mild phenotype.
19165231 Observational study of gene-disease association. (HuGE Navigator)
19158815 Observational study of gene-disease association. (HuGE Navigator)
19143814 Observational study of gene-disease association. (HuGE Navigator)
18987644 Observational study of gene-disease association. (HuGE Navigator)
18295675 IkappaBL allele polymorphisms influences risk of acquiring systemic lupus erythematosus and Sjogren's syndrome.
18295675 Observational study of gene-disease association. (HuGE Navigator)
17855452 A potential role for NFkBL1 in the pathogenesis of rheumatoid arthritis and in mRNA processing or the regulation of translation.
17847930 IL1RN VNTR and the IKBL + 738T > C gene polymorphisms are not risk factors for myocardial infarct in Caucasians with type 2 diabetes
17544510 Observational study of gene-disease association. (HuGE Navigator)
17544510 The IKBL locus itself or another critical gene in this region may confer susceptibility to the development of chronic Chagas cardiomyopathy.
17517687 Observational study of gene-disease association. (HuGE Navigator)
17517687 Minor homozygous genotypes of polymorphisms in NFKBIL1 were associated with moderately protective effects against myocardial infarction.
17485095 no association between polymorphisms and hypertension, myocardial infarct and angina in Irish
17119950 Observational study of gene-disease association. (HuGE Navigator)
16804398 Observational study of gene-disease association. (HuGE Navigator)
16804398 analysis of the NFKB1 protein polymorphism interactions with CARD15/NOD2, IKBL, and IL-1RN genes
16720219 Observational study of gene-disease association. (HuGE Navigator)
16644022 Observational study of gene-disease association. (HuGE Navigator)
16644022 study shows that the estimated haplotype IkBL -421 8T/-62 T tends to be associated with susceptibility to rheumatoid arthritis in Taiwan
16634865 Observational study of gene-disease association. (HuGE Navigator)
16101831 Observational study of gene-disease association. (HuGE Navigator)
15969671 Observational study of gene-disease association. (HuGE Navigator)
15843211 Observational study of genotype prevalence. (HuGE Navigator)
15018649 Observational study of gene-disease association. (HuGE Navigator)
14989711 Observational study of gene-disease association. (HuGE Navigator)
12618859 Observational study of gene-disease association. (HuGE Navigator)
12509789 identifed the second rheumatoid arthritis -susceptibility locus within the HLA region, as the T allele of SNP 96452 (T/A), in the promoter region (position -62) of the I kappa BL gene (P=.0062)
11113070 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)

AA Sequence

MSNPSPQVPEEEASTSVCRPKSSMASTSRRQRRERRFRRYLSAGRLVRAQALLQRHPGLDVDAGQPPPLH      1 - 70
RACARHDAPALCLLLRLGADPAHQDRHGDTALHAAARQGPDAYTDFFLPLLSRCPSAMGIKNKDGETPGQ     71 - 140
ILGWGPPWDSAEEEEEDDASKEREWRQKLQGELEDEWQEVMGRFEGDASHETQEPESFSAWSDRLAREHA    141 - 210
QKCQQQQREAEGSCRPPRAEGSSQSWRQQEEEQRLFRERARAKEEELRESRARRAQEALGDREPKPTRAG    211 - 280
PREEHPRGAGRGSLWRFGDVPWPCPGGGDPEAMAAALVARGPPLEEQGALRRYLRVQQVRWHPDRFLQRF    281 - 350
RSQIETWELGRVMGAVTALSQALNRHAEALK                                           351 - 381
//

Text Mined References (53)

PMID Year Title
25809685 2015 Common Variants and Haplotypes in the TF, TNF-?, and TMPRSS6 Genes Are Associated with Iron Status in a Female Black South African Population.
23953137 2013 A novel link of HLA locus to the regulation of immunity and infection: NFKBIL1 regulates alternative splicing of human immune-related genes and influenza virus M gene.
23128233 2012 Host-microbe interactions have shaped the genetic architecture of inflammatory bowel disease.
22210660 2012 Genetic association study of NF-?B genes in UK Caucasian adult and juvenile onset idiopathic inflammatory myopathy.
20933106 2011 Autoimmune hepatitis, HLA and extended haplotypes.
20854863 2010 Characterization of tumor necrosis factor-? block haplotypes associated with susceptibility to chronic venous leg ulcers in Caucasian patients.
20829348 2010 Cactin targets the MHC class III protein IkappaB-like (IkappaBL) and inhibits NF-kappaB and interferon-regulatory factor signaling pathways.
20662065 2010 Identification of candidate loci at 6p21 and 21q22 in a genome-wide association study of cardiac manifestations of neonatal lupus.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20587610 2010 Examination of genetic polymorphisms in newborns for signatures of sex-specific prenatal selection.
20568399 2010 [Association study between exon 4 NFKBIL1 polymorphism and multiple sclerosis].
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19886988 2009 Association of polymorphism in genes encoding kappaB inhibitors (IkappaB) with susceptibility to and phenotype of Graves' disease: a case-control study.
19851445 2009 High-density SNP screening of the major histocompatibility complex in systemic lupus erythematosus demonstrates strong evidence for independent susceptibility regions.
19773279 2009 Association between genetic variants in VEGF, ERCC3 and occupational benzene haematotoxicity.
19578685 2009 Association study between the -62A/T NFKBIL1 polymorphism and obsessive-compulsive disorder.
19242354 2009 The tumor necrosis factor polymorphism TNF (-308) is associated with susceptibility to meningococcal sepsis, but not with lethality.
19165231 2009 HLA-DPB1 and NFKBIL1 may confer the susceptibility to chronic thromboembolic pulmonary hypertension in the absence of deep vein thrombosis.
19158815 2009 Two-stage case-control association study of polymorphisms in rheumatoid arthritis susceptibility genes with schizophrenia.
19143814 2009 Several loci in the HLA class III region are associated with T1D risk after adjusting for DRB1-DQB1.
18987644 2009 Genetic variants of the HLA-A, HLA-B and AIF1 loci show independent associations with type 1 diabetes in Norwegian families.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18295675 2008 The IkappaBL gene polymorphism influences risk of acquiring systemic lupus erythematosus and Sjögren's syndrome.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17855452 2007 Functional characterization of NF-kappaB inhibitor-like protein 1 (NFkappaBIL1), a candidate susceptibility gene for rheumatoid arthritis.
17847930 2007 The interleukin-1 receptor antagonist gene and the inhibitor of kappa B-like protein gene polymorphisms are not associated with myocardial infarction in Slovene population with type 2 diabetes.
17544510 2008 Variants in the promoter region of IKBL/NFKBIL1 gene may mark susceptibility to the development of chronic Chagas' cardiomyopathy among Trypanosoma cruzi-infected individuals.
17517687 2007 Association of variants in the BAT1-NFKBIL1-LTA genomic region with protection against myocardial infarction in Europeans.
17485095 2008 Lack of association between NFKBIL1/LTA polymorphisms and hypertension, myocardial infarct, unstable angina and stable angina in a large Irish population sample.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
17119950 2007 Two critical genes (HLA-DRB1 and ABCF1)in the HLA region are associated with the susceptibility to autoimmune pancreatitis.
16804398 2006 Role of the NFKB1 -94ins/delATTG promoter polymorphism in IBD and potential interactions with polymorphisms in the CARD15/NOD2, IKBL, and IL-1RN genes.
16720219 Direct determination of single nucleotide polymorphism haplotype of NFKBIL1 promoter polymorphism by DNA conformation analysis and its application to association study of chronic inflammatory diseases.
16644022 2006 Inhibitors of kB-like gene polymorphisms in rheumatoid arthritis.
16634865 2006 Analysis of IL1B, TAP1, TAP2 and IKBL polymorphisms on susceptibility to tuberculosis.
16101831 2005 The haplotype block, NFKBIL1-ATP6V1G2-BAT1-MICB-MICA, within the class III-class I boundary region of the human major histocompatibility complex may control susceptibility to hepatitis C virus-associated dilated cardiomyopathy.
15969671 2005 Haplotype analysis of a 100 kb region spanning TNF-LTA identifies a polymorphism in the LTA promoter region that is associated with atopic asthma susceptibility in Japan.
15843211 2005 TaqMan assays for genotyping of single nucleotide polymorphisms present at a disease susceptibility locus on chromosome 6.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15018649 2004 Complex genetic predisposition in adult and juvenile rheumatoid arthritis.
14989711 2004 IKBL promoter polymorphism is strongly associated with resistance to type 1 diabetes in Japanese.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12618859 2003 Genetic polymorphisms in Spanish rheumatoid arthritis patients: an association and linkage study.
12509789 2003 Identification of I kappa BL as the second major histocompatibility complex-linked susceptibility locus for rheumatoid arthritis.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11113070 2000 Susceptibility to severe ulcerative colitis is associated with polymorphism in the central MHC gene IKBL.
10369924 1999 The central MHC gene IKBL carries a structural polymorphism that is associated with HLA-A3,B7,DR15.
10202016 1999 A new member of the Ig superfamily and a V-ATPase G subunit are among the predicted products of novel genes close to the TNF locus in the human MHC.
9480751 1998 Nucleotide sequencing analysis of the 146-kilobase segment around the IkBL and MICA genes at the centromeric end of the HLA class I region.
8499947 1993 Dense Alu clustering and a potential new member of the NF kappa B family within a 90 kilobase HLA class III segment.
8081366 1994 Characterization of a novel gene in the human major histocompatibility complex that encodes a potential new member of the I kappa B family of proteins.