Property Summary

NCBI Gene PubMed Count 46
PubMed Score 20.62
PubTator Score 10.64

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (6)

Disease log2 FC p
esophageal adenocarcinoma 1.100 1.8e-02
interstitial cystitis 1.100 3.3e-03
intraductal papillary-mucinous neoplasm ... 1.200 3.9e-02
lung adenocarcinoma 1.700 2.2e-16
medulloblastoma, large-cell -1.400 5.9e-06
ovarian cancer 1.300 6.1e-05

Gene RIF (31)

AA Sequence

MNQRRSESRPGNHRLQAYAEPGKGDSGGAGPLSGSARRGRGGGGAIRVRRPCWSGGAGRGGGPAWAVRLP      1 - 70
TVTAGWTWPALRTLSSLRAGPSEPHSPGRRPPRAGRPLCQADPQPGKAARRSLEPDPAQTGPRPARAAGM     71 - 140
SEARKGPDEAEESQYDSGIESLRSLRSLPESTSAPASGPSDGSPQPCTHPPGPVKEPQEKEDADGERADS    141 - 210
TYGSSSLTYTLSLLGGPEAEDPAPRLPLPHVGALSPQQLEALTYISEDGDTLVHLAVIHEAPAVLLCCLA    211 - 280
LLPQEVLDIQNNLYQTALHLAVHLDQPGAVRALVLKGASRALQDRHGDTALHVACQRQHLACARCLLEGR    281 - 350
PEPGRGTSHSLDLQLQNWQGLACLHIATLQKNQPLMELLLRNGADIDVQEGTSGKTALHLAVETQERGLV    351 - 420
QFLLQAGAQVDARMLNGCTPLHLAAGRGLMGISSTLCKAGADSLLRNVEDETPQDLTEESLVLLPFDDLK    421 - 490
ISGKLLLCTD                                                                491 - 500
//

Text Mined References (48)

PMID Year Title