Property Summary

NCBI Gene PubMed Count 4
PubMed Score 17.84
PubTator Score 2.72

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
non-small cell lung cancer 2798 3.0e-16
osteosarcoma 7933 1.9e-04
Rheumatoid Arthritis 1170 4.2e-02

Expression

  Differential Expression (3)

Disease log2 FC p
Rheumatoid Arthritis -1.200 4.2e-02
osteosarcoma 1.157 1.9e-04
non-small cell lung cancer -1.469 3.0e-16

Synonym

Accession Q8NI38 Q8NI39 Q9BRG9
Symbols TA-NFKBH
IkappaBNS

Gene

PANTHER Protein Class (1)

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Protein-protein Interaction (4)

Gene RIF (1)

PMID Text
25349408 The unique ability of p100/IkappaBdelta to stably interact with all NF-kappaB subunits by forming kappaBsomes demonstrates its importance in sequestering NF-kappaB subunits and releasing them as dictated by specific stimuli for developmental programs.

AA Sequence

MEAGPWRVSAPPSGPPQFPAVVPGPSLEVARAHMLALGPQQLLAQDEEGDTLLHLFAARGLRWAAYAAAE      1 - 70
VLQVYRRLDIREHKGKTPLLVAAAANQPLIVEDLLNLGAEPNAADHQGRSVLHVAATYGLPGVLLAVLNS     71 - 140
GVQVDLEARDFEGLTPLHTAILALNVAMRPSDLCPRVLSTQARDRLDCVHMLLQMGANHTSQEIKSNKTV    141 - 210
LHLAVQAANPTLVQLLLELPRGDLRTFVNMKAHGNTALHMAAALPPGPAQEAIVRHLLAAGADPTLRNLE    211 - 280
NEQPVHLLRPGPGPEGLRQLLKRSRVAPPGLSS                                         281 - 313
//

Text Mined References (6)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
25349408 2014 p100/I?B? sequesters and inhibits NF-?B through kappaBsome formation.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15177553 2004 T lymphocyte activation gene identification by coregulated expression on DNA microarrays.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.