Tchem | NF-kappa-B inhibitor alpha |
Inhibits the activity of dimeric NF-kappa-B/REL complexes by trapping REL dimers in the cytoplasm through masking of their nuclear localization signals. On cellular stimulation by immune and proinflammatory responses, becomes phosphorylated promoting ubiquitination and degradation, enabling the dimeric RELA to translocate to the nucleus and activate transcription.
This gene encodes a member of the NF-kappa-B inhibitor family, which contain multiple ankrin repeat domains. The encoded protein interacts with REL dimers to inhibit NF-kappa-B/REL complexes which are involved in inflammatory responses. The encoded protein moves between the cytoplasm and the nucleus via a nuclear localization signal and CRM1-mediated nuclear export. Mutations in this gene have been found in ectodermal dysplasia anhidrotic with T-cell immunodeficiency autosomal dominant disease. [provided by RefSeq, Aug 2011]
This gene encodes a member of the NF-kappa-B inhibitor family, which contain multiple ankrin repeat domains. The encoded protein interacts with REL dimers to inhibit NF-kappa-B/REL complexes which are involved in inflammatory responses. The encoded protein moves between the cytoplasm and the nucleus via a nuclear localization signal and CRM1-mediated nuclear export. Mutations in this gene have been found in ectodermal dysplasia anhidrotic with T-cell immunodeficiency autosomal dominant disease. [provided by RefSeq, Aug 2011]
Comments
Property Summary
Ligand Count | 3 |
NCBI Gene PubMed Count | 386 |
PubMed Score | 1979.77 |
PubTator Score | 1533.46 |
Disease | Target Count | P-value |
---|---|---|
astrocytoma | 1146 | 3.6e-21 |
lung carcinoma | 2843 | 3.7e-17 |
non-small cell lung cancer | 2890 | 3.4e-14 |
oligodendroglioma | 2850 | 2.2e-13 |
ovarian cancer | 8520 | 1.4e-08 |
lung adenocarcinoma | 2716 | 2.1e-08 |
posterior fossa group A ependymoma | 468 | 1.2e-06 |
lung cancer | 4740 | 2.0e-06 |
cystic fibrosis | 1696 | 4.8e-05 |
acute myeloid leukemia | 783 | 9.9e-04 |
adrenocortical carcinoma | 1428 | 1.1e-03 |
Pick disease | 1894 | 1.2e-03 |
pancreatic cancer | 2398 | 2.3e-03 |
Rheumatoid arthritis | 1191 | 2.5e-03 |
acute quadriplegic myopathy | 1158 | 3.8e-03 |
primary pancreatic ductal adenocarcinoma | 1109 | 4.8e-03 |
subependymal giant cell astrocytoma | 2287 | 1.3e-02 |
colon cancer | 1478 | 1.3e-02 |
glioblastoma | 5792 | 2.2e-02 |
dermatomyositis | 966 | 2.9e-02 |
Disease | Target Count |
---|---|
Hypohidrotic ectodermal dysplasia with immunodeficiency | 2 |
Disease | log2 FC | p |
---|---|---|
psoriasis | 1.700 | 1.4e-04 |
acute myeloid leukemia | 2.300 | 9.9e-04 |
acute quadriplegic myopathy | 1.146 | 3.8e-03 |
adrenocortical carcinoma | -1.039 | 1.1e-03 |
astrocytoma | 1.400 | 3.6e-21 |
colon cancer | -1.500 | 1.3e-02 |
cystic fibrosis | 1.727 | 4.8e-05 |
dermatomyositis | 1.100 | 2.9e-02 |
glioblastoma | 1.400 | 2.2e-02 |
lung adenocarcinoma | -1.400 | 2.1e-08 |
lung cancer | -3.600 | 2.0e-06 |
lung carcinoma | -1.800 | 3.7e-17 |
non-small cell lung cancer | -1.226 | 3.4e-14 |
oligodendroglioma | 1.300 | 2.2e-13 |
ovarian cancer | 2.800 | 1.4e-08 |
pancreatic cancer | 1.300 | 2.3e-03 |
Pick disease | 1.400 | 1.2e-03 |
posterior fossa group A ependymoma | 1.300 | 1.2e-06 |
primary pancreatic ductal adenocarcinoma | 1.241 | 4.8e-03 |
Rheumatoid arthritis | 1.100 | 2.5e-03 |
subependymal giant cell astrocytoma | 1.289 | 1.3e-02 |
Species | Source | Disease |
---|---|---|
Inparanoid EggNOG | ||
Inparanoid OMA EggNOG | ||
OMA EggNOG | ||
Inparanoid OMA EggNOG | ||
Inparanoid OMA EggNOG | ||
Inparanoid OMA EggNOG | ||
Inparanoid OMA EggNOG | ||
OMA EggNOG | ||
Inparanoid OMA EggNOG | ||
Inparanoid EggNOG | ||
Inparanoid OMA EggNOG | ||
Inparanoid OMA | ||
OMA EggNOG | ||
Inparanoid OMA EggNOG | ||
Inparanoid OMA EggNOG |
MFQAAERPQEWAMEGPRDGLKKERLLDDRHDSGLDSMKDEEYEQMVKELQEIRLEPQEVPRGSEPWKQQL 1 - 70 TEDGDSFLHLAIIHEEKALTMEVIRQVKGDLAFLNFQNNLQQTPLHLAVITNQPEIAEALLGAGCDPELR 71 - 140 DFRGNTPLHLACEQGCLASVGVLTQSCTTPHLHSILKATNYNGHTCLHLASIHGYLGIVELLVSLGADVN 141 - 210 AQEPCNGRTALHLAVDLQNPDLVSLLLKCGADVNRVTYQGYSPYQLTWGRPSTRIQQQLGQLTLENLQML 211 - 280 PESEDEESYDTESEFTEFTEDELPYDDCVFGGQRLTL 281 - 317 //