Property Summary

NCBI Gene PubMed Count 362
PubMed Score 1960.89
PubTator Score 1533.46

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (21)

Disease log2 FC p
psoriasis 1.700 1.4e-04
Rheumatoid Arthritis 1.100 2.5e-03
astrocytoma 1.400 3.6e-21
glioblastoma 1.400 2.2e-02
oligodendroglioma 1.300 2.2e-13
cystic fibrosis 1.727 4.8e-05
acute quadriplegic myopathy 1.146 3.8e-03
adrenocortical carcinoma -1.039 1.1e-03
primary pancreatic ductal adenocarcinoma 1.241 4.8e-03
non-small cell lung cancer -1.226 3.4e-14
lung cancer -4.300 1.9e-07
colon cancer -1.500 1.3e-02
posterior fossa group A ependymoma 1.300 1.2e-06
subependymal giant cell astrocytoma 1.289 1.3e-02
lung adenocarcinoma -1.400 2.1e-08
lung carcinoma -1.800 3.7e-17
Pick disease 1.400 1.2e-03
acute myeloid leukemia 3.200 4.8e-02
ovarian cancer 2.800 1.4e-08
pancreatic cancer 1.300 2.3e-03
dermatomyositis 1.100 2.9e-02

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
445 confirmatory 40 / 24714 / 87312 IkB Signaling

Gene RIF (288)

PMID Text
27151455 Activated Rac1 regulates the degradation of IkappaBalpha and the nuclear translocation of STAT3-NFkappaB complexes in starved cancer cells
26691317 mutation in Chinese patient results in mycobacterial infections without ectodermal dysplasia
26647777 DAT stabilized IkBa by inhibiting the phosphorylation of Ika by the IkB kinase (IKK) complex. DAT induced proteasomal degradation of TRAF6, and DAT suppressed IKKb-phosphorylation through downregulation of TRAF6
26488500 the rs3138053 polymorphism of NFKBIA gene is a candidate for susceptibility to overall cancers, while rs696 plays a protective role [meta-analysis]
26477820 genetic variation associated with susceptibility to acute kidney injury
26446987 HIV-1 Tat degrades of NFKBIA (IKappaBalpha)) in CRT-MG human astroglioma cells
26347747 HIV-1 Tat degrades of NFKBIA (IKappaBalpha)) in CRT-MG human astroglioma cells
26295305 Identify a novel BCR-ABL/IkappaBalpha/p53 network, whereby BCR-ABL functionally inactivates a key tumor suppressor in chronic myeloid leukemia.
26252270 This review and meta-analysis of the association of NFKBIA -881 A>G polymorphism with cancer susceptibility reveals that -881 A>G polymorphism may increase risk of cancer development in Asian populations.
26239140 MicroRNA-19a mediates gastric carcinoma cell proliferation through the activation of IkappaBalpha.
26178989 HIV-1 Tat degrades of NFKBIA (IKappaBalpha)) in CRT-MG human astroglioma cells
26161396 genetic variants in NFkappaB1 (rs28362491del>ins ATTG) and IkappaBalpha (rs696G>A) and their synergistic effect might contribute to nasopharyngeal carcinoma predisposition.
26075907 HIV-1 Tat degrades of NFKBIA (IKappaBalpha)) in CRT-MG human astroglioma cells
26075620 Our study indicates that NFKB1-94 ins/del ATTG polymorphism may play a role in CAD susceptibility in Chinese Uygur population
26068031 This study aimed to examine the association between NFKB19-4 ATTG ins-->del, NFKBIA 3' UTR A-->G, -826CT and -881AG polymorphisms and prostate cancer risk among Chinese.
26031809 HIV-1 Tat degrades of NFKBIA (IKappaBalpha)) in CRT-MG human astroglioma cells
25974152 miR-126 may play an important role in hepatic fibrosis by downregulating the expression of IkappaBalpha partly through the NF-kappaB signaling pathway.
25943894 HIV-1 Tat degrades of NFKBIA (IKappaBalpha)) in CRT-MG human astroglioma cells
25937534 SM22alpha is a phosphorylation-regulated suppressor of IKK-IkappaBalpha-NF-kappaB signaling cascades.
25930675 Data indicate the involvement of the p38 MAPK/NF-kappaB/IkappaBalpha pathway in Newcastle disease virus (NDV) infection and subsequent induction of apoptosis in clear cell renal cell carcinoma (ccRCC) cells.
25636783 HIV-1 Tat degrades of NFKBIA (IKappaBalpha)) in CRT-MG human astroglioma cells
25620704 HIV-1 Tat degrades of NFKBIA (IKappaBalpha)) in CRT-MG human astroglioma cells
25577468 Data suggest that activity of IKBalpha can be regulated by dietary factors; dietary supplementation with luteolin inhibits vascular endothelial inflammation by suppressing IKBalpha/NFkappaB signaling.
25374080 Expression of IkappaBalpha in human bladder cancer cells is negatively correlated with epithelial-mesenchymal transition and tumor invasion in vitro.
25367031 the wild genotypes of both two single nucleotide polymorphisms (ins/ins and AA genotypes) and ins/ins/AA combined NFKB1 rs28362491 and NFKBIA rs696 genotype are strongly associated with enhanced risk of Behcet's disease in a Turkish population.
25361605 IkappaBetaalpha inhibits apoptosis at the outer mitochondrial membrane independently of NF-kappaB retention.
25352423 Study demonstrates an association between functional polymorphisms of IkappaBalpha rs696 and smoking with the risk of defective spermatogenesis, suggesting some interaction between the NF-kappaB signalling pathway and smoking-related ROS in human spermatogenesis.
25326706 NFKBIA-rs2233419AG was associated with a significantly increased risk of developing recurrent wheezing.
25215581 The single nucleotide polymorphism rs1957106 CT and TT genotypes were found to be associated with lower NFKBIA protein levels and a poor prognosis of pateints with glioblastoma.
25112903 data suggest that the NFKBIA 126 G/A polymorphism might be potentially helpful to identify liver transplant recipients with an increased susceptibility to develop recurrent acute rejections
25008924 HIV-1 Tat degrades of NFKBIA (IKappaBalpha)) in CRT-MG human astroglioma cells
24578542 No association was observed between NFKBIA variants and risk of liver cancer.
24504166 MiR-196a promotes pancreatic cancer progression by targeting nuclear factor kappa-B-inhibitor alpha.
24463357 miR-196a can directly interact with IkappaBalpha 3'-UTR to suppress IkappaBalpha expression and subsequently promote activation of NF-kappaB
24457201 IkappaBalpha sequesters not only p65 but also RPS3 in the cytoplasm.
24368589 This study reveals that polymorphisms in the IkB-alpha promoter (-881 A/G, -826 C/T) are strongly associated with the susceptibility of Iranian Multiple Sclerosis patients
24367071 during IkappaBalpha-mediated dissociation of NF-kappaB from DNA, a ternary complex forms, and rapidly rearranges to release DNA
24361600 The results of this study suggested that oligodendroglial IkappaBalpha expression and NF-kappaB are activated early in the course of MSA and their balance contributes to the decision of cellular demise.
24330732 data indicate that NFKBIA deletions are present but not frequent in Glioblastoma multiforme (GBM); the deletions become frequent in GBM neurospheres (NS), an event that seems to be affected by the presence of EGF in the culture medium
24324738 Association of common polymorphisms in TNFA, NFkB1 and NFKBIA with risk and prognosis of esophageal squamous cell carcinoma in northern Indian population, was investigated.
24295474 NF-kB expression was downregulated and its cytoplasmatic inhibitor IKBalpha was increased in CTLA4-Ig treated macrophages.
24248593 Data indicate that the p97-UFD1L-NPL4 protein complex specifically associates with ubiquitinated IkappaBalpha via the interactions between p97 and the SCF(beta-TRCP) ubiquitin ligase.
24085292 long-term incubation with PIs activates NF-kappaB, which is mediated by IkappaBalpha degradation via the lysosome in an IKK-dependent and IKK-independent manner.
23996241 No statistically significant CRC risk association was found for the NFKBIA polymorphisms.
23898208 HIV-1 Tat degrades of NFKBIA (IKappaBalpha)) in CRT-MG human astroglioma cells
23774506 HIV-1 Tat degrades of NFKBIA (IKappaBalpha)) in CRT-MG human astroglioma cells
23697845 Data indicate that following bortezomib treatment there was accumulation of IkappaB-alpha (IkappaBalpha) without affecting its phosphorylation status at an early time point.
23563313 CCDC22 participates in NF-kappaB activation and its deficiency leads to decreased IkappaB turnover
23555990 These data show that I-kappa-B-alpha can be used as a prognostic marker and target for therapy in Activated B-cell lymphoma, one of the three subtypes of Diffuse Large B-cell Lymphoma.
23487427 Immunologically relevant genetic variation in the promoter of NFKBIA is differentially susceptibile to severe bronchiolitis following infection with respiratory syncytial virus, airway hyperresponsiveness, and severe bronchopulmonary dysplasia.
23457512 NFKB1 -94 Ins promoter polymorphism increased the risk of hepatocellular carcinoma (HCC), and may be applied as a predictive factor for the clinical stage and tumor size in female HCC patients.
23453579 Authors discover that HIV-1 infection elevates the phosphorylation of IkappaBalpha and p100, and that this increase is greatly reduced when a Vpr-negative HIV-1 is used for infection.
23453579 HIV-1 Tat degrades of NFKBIA (IKappaBalpha)) in CRT-MG human astroglioma cells
23439505 the silencing of NFKBIA may play an important role in the carcinogenesis of adenocarcinomas independent of EGFR/K-ras mutations or EML4-ALK fusion.
23422506 The findings from this human cell study in vitro indicate that both relatively high single-dose and chronic opioid exposure may induce the structural changes in the developing human brain and the adult brain by altering the expression of neuronal differentiation- and neurite outgrowth-related genes IkappaBa and TrkB in vivo.
23377923 the analysis of IkappaBalpha expression at salivary gland epithelial cell level could be a potential new hallmark of Sjogren's syndrome progression.
23322360 a common susceptible mechanism of inflammation in lung induced by genetic variants in NFkappaB1 (-94del>ins ATTG) or IkappaBalpha (2758G>A) to predict risk of COPD or lung cancer.
23285182 miR-126 may play roles in UC inflammatory activity by down-regulating the expression of IKBA, an important inhibitor of NF-kappaB signaling pathway.
23274114 YLTA mutations stabilize the I-kappa-B-alpha to proteasomal degradation.
23251686 HIV-1 Tat degrades of NFKBIA (IKappaBalpha)) in CRT-MG human astroglioma cells
23250755 TOPK directly interacted with and phosphorylated IkappaBalpha at Ser-32, leading to p65 nuclear translocation and NF-kappaB activation.
23069812 Epithelial-mesenchymal transformation, along with acquisition of a tumor stem cell-like phenotype mediated by IKKbeta/IkappaBalpha/RelA signal pathway via Snail, contributes to a low concentration of arsenite-induced tumorigenesis.
23054188 Pokemon activates the expression of both p65 and IkappaBalpha by sequence-specific binding to their promoters and plays a dual role in regulating NF-kappaB signaling.
23046941 The expressions of NF-kappaBp65 and IkappaBalpha are negatively correlated in gestational trophoblastic tumor tissues.
23001849 HIV-1 Tat degrades of NFKBIA (IKappaBalpha)) in CRT-MG human astroglioma cells
22935973 Our findings clearly demonstrate changes in the levels of IkappaBalpha in Sjogren's syndrome monocytes, suggesting that the attenuated expression of IkappaBalpha could contribute to the deregulation of NF-kappaB pathways in Sjogren's syndrome pathogenesis.
22509384 Our results suggest that NFKB1 -94 ATTG2, NFKBIA -826 T, and -881 G alleles are associated with oral carcinogenesis
22393418 bortezomib-induced autophagy confers relative DLBCL cell drug resistance by eliminating I-kappaBalpha.
22302838 The endothelium plays important roles in obesity- and age-related disorders through intracellular NF-kappaB signaling, thereby ultimately affecting life span.
22187158 HIV-1 Tat degrades of NFKBIA (IKappaBalpha)) in CRT-MG human astroglioma cells
22184009 MIB1 negatively regulates TNFalpha- and IL1beta- induced NF-kappaB target gene activation
22156201 in glioma cell lines that microRNA-30e* (miR-30e*) directly targets the IkappaBalpha 3'-UTR and suppresses IkappaBalpha expression
22078572 A novel mutation in the IKBA gene was discovered in an infant with autosomal-dominant anhidroticectodermal dysplasia with immune deficiency syndrome
22022389 These results suggest the existence of a reservoir of monoubiquitylated IkappaBalpha resistant to TNFalpha-induced proteolysis.
21951552 HIV-1 Tat degrades of NFKBIA (IKappaBalpha)) in CRT-MG human astroglioma cells
21778941 deletion of NFKBIA and amplification of EGFR show a pattern of mutual exclusivity in glioblastoma multiforme[review]
21712995 HIV-1 Tat degrades of NFKBIA (IKappaBalpha)) in CRT-MG human astroglioma cells
21664225 HIV-1 Tat degrades of NFKBIA (IKappaBalpha)) in CRT-MG human astroglioma cells
21606193 Data show that IkappaB kinase beta (IKKbeta) can be activated in the nucleus by Nkx3.2 in the absence of exogenous IKK-activating signals, allowing constitutive nuclear degradation of IkappaB-alpha.
21454528 CCL5 signaling induces GLI2 through a PI3K-AKT-IkappaBalpha-p65 pathway and requires GLI2 transcriptional activity to modulate IL-6 expression and Ig secretion in vitro and in vivo
21376060 rs17103265 deletion homozygote is a genetic risk factor for gastric cancer, especially for certain subtypes in a southern Chinese population
21263074 alpha-1-antitrypsin blocks nuclear translocation of NF-kappaB p50/p65 despite an unexpected elevation in associated phosphorylated and ubiquitinated IkappaBalpha.
21228035 Data show that IKBalpha, NFKB2, and TRAF3 gene polymorphisms play a role in the development of multiple myeloma and in the response to bortezomib therapy.
21220295 Studies indicate that even at high concentrations of DNA, IkappaBalpha remains associated with NF-kappaB.
21175585 HIV-1 Tat degrades of NFKBIA (IKappaBalpha)) in CRT-MG human astroglioma cells
21175304 Deletion of NFKBIA has an effect that is similar to the effect of EGFR amplification in the pathogenesis of glioblastoma and is associated with comparatively short survival.
21048031 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20953190 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
20953189 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
20890592 Acrolein causes the decrease in nitric oxide production as an I-kappaBalpha-independent downregulator of NF-kappaB activity in human malignant keratinocytes.
20836841 Polymorphism in NFkB was associated with colorectal cancer.
20811626 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20797629 Nuclear IKKbeta acts as an adaptor protein for IkappaBalpha degradation in UV-induced NF-kappaB activation. NF-kappaB activated by the nuclear IKKbeta adaptor protein suppresses anti-apoptotic gene expression and promotes UV-induced cell death.
20716621 Observational study of gene-disease association. (HuGE Navigator)
20696864 Although p65 recruitment to TNF-alpha, IL-1ss, and IL-6 promoters is inhibited by nuclear IkappaBkappaalpha, recruitment to interleukin (IL)-8 promoter is not repressed.
20674643 gene polymorphisms is associated with the development of asthma in Korea
20674643 Observational study of gene-disease association. (HuGE Navigator)
20659425 TGase 2-mu-calpain system is significant in the NF-kappaB pathway via I-kappaBalpha polymerization and subsequent degradation.
20652762 alpha-mangostin also strongly inhibited PMA-induced degradation of inhibitor of kappaBalpha (IkappaBalpha)
20628624 Meta-analysis of gene-disease association. (HuGE Navigator)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20568250 Observational study of gene-disease association. (HuGE Navigator)
20563630 promoter polymorphism is associated with susceptibility to rheumatoid arthritis in Taiwain
20563630 Observational study of gene-disease association. (HuGE Navigator)
20546338 Total and phosphorylated IkappaBalpha protein expression might serve as markers for NF-kappaB activation in human ovarian carcinoma.
20503287 Observational study of gene-disease association. (HuGE Navigator)
20495844 This meta-analysis demonstrates that autoimmune and inflammatory diseases are associated with NFKBIA gene -826C/T polymorphism, but not with 2758A/G, -881A/G, and -279C/T.
20495844 Meta-analysis of gene-disease association. (HuGE Navigator)
20453000 Observational study of gene-disease association. (HuGE Navigator)
20448286 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20388715 Inflammation anergy in human intestinal macrophages is due to Smad-induced IkappaBalpha expression and NF-kappaB inactivation
20385620 Data show that RSK2 is activated by treatment with tumor necrosis factor-alpha (TNF-alpha) and directly phosphorylates IkappaBalpha at Ser-32, leading to IkappaBalpha degradation.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20379146 Observational study and genome-wide association study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20335171 Proteasome inhibitor PS-341 (bortezomib) induces calpain-dependent IkappaB(alpha) degradation.
20304615 The allele frequency and genotype distribution of NFKBIA gene polymorphism did not differ between myocardial infarction and control group.
20304615 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20193848 NFKBIA mRNA was strongly expressed in H-RS cells from Hodgkin lymphoma sections, and little was detected in the reactive surrounding lymphocytes.
20164548 IKBA -826T allele, IKBA -881A -826T -550A -519C -297C haplotype, and IKBA -881A -826T -550A -519T -297C haplotype may be related to susceptibility to Behcet's disease. IKBA -826T/T is associated with skin lesions in patients with Behcet's disease.
20164548 Observational study of gene-disease association. (HuGE Navigator)
20132559 I kappaB alpha rs2233408 T heterozygotes were associated with reduced risk of gastric cancer, especially for the development of certain subtypes of gastric cancer in Chinese population.
20080849 Case report. this patient's IkappaBalpha mutation caused GH and IGF-l resistance which, in turn, contributed to his growth failure.
20068069 Elevated levels of sCLU promote prostate cancer cell survival by facilitating degradation of COMMD1 and I-kappaB, thereby activating the canonical NF-kappaB pathway.
20056178 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20012522 HIV-1 Tat degrades of NFKBIA (IKappaBalpha)) in CRT-MG human astroglioma cells
19948975 Observational study of gene-disease association, gene-gene interaction, gene-environment interaction, and genetic testing. (HuGE Navigator)
19941056 Observational study of genotype prevalence. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19891769 Aurora-A, via activating Akt, stimulated nuclear factor-kappaB signaling pathway to promote cancer cell survival.
19886988 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19816602 Expression and activity of MMP-2 was enhanced by the IkappaBalpha siRNA in human ciliary muscle cells through the activation of the NF-kappaB signaling pathway.
19798070 Subjects with at least one A allele for NFKBIA rs1951276 had approximately 29% lower insulin sensitivity compared to individuals homozygous for the G allele...
19797428 NFKBIA -826T and -881AG were associated with the risk of hepatocellular carcinoma in the subjects infected with HBV genotype C
19773451 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19773279 Observational study of gene-disease association. (HuGE Navigator)
19758175 Data show that actively invading CD4(+) cells in PM and sIBM contained both p65 and p50, whereas I-kappaB alpha was absent.
19733238 Results indicate that regulation of the IkappaBalpha level is one of the underlying mechanisms by which C/EBP-beta controls NF-kappaappaB-associated signalling.
19673747 Observational study of gene-disease association. (HuGE Navigator)
19648161 NFKBIA low mutation frequency plays a minor role in the NF-kappaB activity of nodular lymphocyte-predominant Hodgkin's lymphoma (NLPHL), suggesting different mechanisms of NF-kappaB activation in NLPHL compared to classical Hodgkin's lymphoma (cHL).
19622906 HIV-1 Tat degrades of NFKBIA (IKappaBalpha)) in CRT-MG human astroglioma cells
19591507 The nuclear magnetic resonance results and residual dipolar coupling experiments presented here strongly indicate that this fragment of IkappaappaBalpha (67-206) represents the well-folded part of the IkappaappaBalpha ankyrin repeat domain.
19573080 Observational study of gene-disease association. (HuGE Navigator)
19554506 The expression of NFKBIA gene of NF-kappaB pathway in multiple myeloma using bone marrow aspirates obtained at diagnosis is reported.
19543524 20-Hydroxycholecalciferol, product of vitamin D3 hydroxylation by P450scc, decreases NF-kappaB activity by increasing IkappaB alpha levels in human keratinocytes
19527514 Observational study of gene-disease association. (HuGE Navigator)
19522780 Constitutive inactivation of the NF-kappaB pathway in IkappaBalpha-double negative transgenic mice attenuates the non-permissive properties of reactive astrocytes, leading to an increased ability of neurons to sustain injury and regenerate their axons.
19507254 Mutations of NFKBIA, encoding IkappaB alpha, are a recurrent finding in classical Hodgkin lymphoma but are not a unifying feature of non-EBV-associated cases.
19500386 NFKBIA and NFKBIB are not likely to harbor ovarian cancer risk alleles.
19500386 Observational study of gene-disease association. (HuGE Navigator)
19456861 Data suggest that IkappaB alpha, owing to its interactions with NF-kappaB and HIF-1alpha, may play a pivotal role in the crosstalk between the molecular events that underlie inflammatory and hypoxic responses.
19453261 Observational study of gene-disease association. (HuGE Navigator)
19363678 IkBalpha promoter polymorphisms are related to susceptibility to ankylosing spondylitis in Taiwan.
19363678 Observational study of gene-disease association. (HuGE Navigator)
19297320 Adenosine signaling mediates SUMO-1 modification of IkappaBalpha during hypoxia and reoxygenation.
19296948 Compared with normal endometrium, progesterone receptor isoform B (PR-B) and IkappaBalpha immunoreactivity were statistically significantly reduced in ectopic as well as eutopic endometrium from women with adenomyosis.
19258923 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19223558 Observational study of gene-disease association. (HuGE Navigator)
19213954 overexpression of Nur77 significantly increased IkappaBalpha promoter activity via directly binding to a Nur77 response element in the IkappaBalpha promoter
19187648 The findings indicate that IkappaBalphaM inhibits the activation of NF-kappaB. It significantly up-regulates TIMP-2 expression in human malignant glioma cells and down-regulates the expression of MMP-9.
19046417 These data suggest a mechanism for maintaining NF-kappaB activity in human T cells through the binding of the Caspase-3-generated carboxy-terminal fragment of p65/RelA to IkappaBalpha in order to protect wild-type p65/RelA from IkappaBalpha inhibition.
19046417 HIV-1 Tat degrades of NFKBIA (IKappaBalpha)) in CRT-MG human astroglioma cells
19019440 c-mip inhibits the degradation of I-kappaBalpha and impedes the dissociation of the NF-kappaB/I-kappaBalpha complexes.
18981184 tumor suppressor protein SMAR1 can modulate NF-kappaB transactivation and inhibit tumorigenesis by regulating NF-kappaB target genes
18950845 Observational study of gene-disease association. (HuGE Navigator)
18818748 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18716880 NFKBIA 3'UTR GG genotype associated with an increased risk for extensive colitis in Hungarian inflammatory bowel disease patients
18716880 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18672082 HIV-1 Tat degrades of NFKBIA (IKappaBalpha)) in CRT-MG human astroglioma cells
18660489 Observational study of gene-disease association. (HuGE Navigator)
18636537 Blocking NF-kappaB with IKKbeta- or RelA siRNA substantially sensitized Adriamycin-induced cytotoxicity
18636124 Observational study of gene-disease association. (HuGE Navigator)
18606063 Transfection of IkappaBalpha can inhibit NF-kappaB activity, thus inhibit cell invasion of A549, which may be through the down-regulation of MMP-2 and MMP-9 expressions.
18600435 promoter polymorphisms is associated with susceptibility to primary Sjogren's syndrome in Taiwan
18555796 Cys(189) of IkappaB alpha is a target for S-glutathionylation.
18515365 Interleukin (IL) 1beta induction of IL-6 is mediated by a novel phosphatidylinositol 3-kinase-dependent AKT/IkappaB kinase alpha pathway targeting activator protein-1
18511071 These data demonstrate clearly that the coupled folding and binding of IkappaBalpha is critical for its precise control of NF-kappaB transcriptional activity.
18474597 H(2)O(2) prolongs NF-kappaB activation in co-stimulated cells by suppressing the negative regulatory functions of Cezanne and IkappaBalpha.
18434448 Observational study of gene-disease association. (HuGE Navigator)
18356846 NF-kappaB, IkappaB-alpha, IkappaB-beta mRNA decreased significantly after weight loss.
18260825 The canonical IKK2/IkappaBalpha pathway of NF-kappaB activation mediates the up-regulation of RGS4 expression in response to IL-1beta.
18215193 cytoplasmic pI kappaB-alpha expression in non-small cell lung cancer that independently predict overall survival have been identified.
18199400 There was a negative correlation between the expression of I Kappa B-alpha mRNA level and acute physiology in multiple organ dysfunction syndrome.
18071880 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18071880 IkappaBalpha -826 T nucleotide promoter polymorphism may be a risk factor for the development of systemic lupus erythematosus in Taiwanese.
17991436 reduction of phosphorylation leads to nuclear retention of p65, which might be partly responsible for altered transcriptional behavior of p65 serine mutants
17942396 IkappaB-alpha negatively regulates the HIV-1 expression and replication in an NF-kappaB-independent manner by directly binding to Tat
17942396 HIV-1 Tat degrades of NFKBIA (IKappaBalpha)) in CRT-MG human astroglioma cells
17910475 Tyrosine nitration of IKBA reveals a novel mechanism for NF-kappaB activation.
17703412 Observational study of gene-disease association. (HuGE Navigator)
17701919 NFKB and NFKBI polymorphisms have roles in susceptibility of tumour and other diseases [review]
17681786 Berberine suppressed Il-1beta/TNF-alpha production in lung inflammation models. Suppression was dependent on inhibition of IkappaB-alpha phosphorylation and degradation.
17607549 Hyaluronan of intrinsic molecular weight suppresses LPS-stimulated production of proinflammatory cytokines via ICAM-1 through down-regulation of NF-kappaB and IkappaB
17593226 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
17492467 Observational study of gene-disease association. (HuGE Navigator)
17492467 Polymorphisms in NF-kappaB1 and NF-kappaBIalpha genes is associated with melanoma
17463416 Observational study of gene-disease association. (HuGE Navigator)
17463416 NFKBIA polymorphisms associate with susceptibility to pneumococcal disease.
17354114 Observational study of gene-disease association. (HuGE Navigator)
17354114 Chinese individuals >or=50 years of age carrying the AG genotype of NFKBIA may be at an increased risk of developing colorectal cancer, and the GG genotype of NFKBIA may be considered as a prognostic factor for Swedish patients.
17351338 IkappaBalpha acts as a sensor of viral infection.
17333217 Observational study of gene-disease association. (HuGE Navigator)
17318773 Observational study of gene-disease association. (HuGE Navigator)
17318773 Polymorphisms in NFKBIA gene associated with type 1 diabetes.
17316064 I-kappa B alpha, the inhibitory subunit of NF-kappa B (a transcription factor activated by oxidative stress), was upregulated following wounding.
17307728 Immature intestinal epithelial cells have increased IKKbeta expression & phosphorylation compared with adult IEC.
17284228 Observational study of gene-disease association. (HuGE Navigator)
17284228 The IkappaBalpha-826 T and -550 A alleles are associated with susceptibility to rheumatoid arthritis .
17148610 IkappaBalpha conformational flexibility and regions of IkappaBalpha folding upon binding to NF-kappaB are important attributes for its regulation of NF-kappaB transcriptional activity
17115186 Observational study of gene-disease association. (HuGE Navigator)
17062574 DSCR1 attenuates NF-kappaB-mediated transcriptional activation by stabilizing its inhibitory protein, IkappaBalpha
17003112 Human HIF asparaginyl hydroxylase, factor inhibiting HIF (FIH), also efficiently hydroxylates specific asparaginyl (Asn)-residues within proteins of the IkappaB family.
16955245 heat shock increases IkappaBalpha gene expression primarily by increasing Ikappa Balpha mRNA stability and this effect is partially dependent on p38 MAP kinase.
16931600 Results indicate that 14-3-3 proteins facilitate the nuclear export of IkappaBalpha-p65 complexes and are required for the appropriate regulation of NFkappaB signaling.
16919536 glucose intake induces an immediate increase in intranuclear NF-kappaB binding, a fall in IkappaBalpha, an increase in IKKalpha, IKKbeta, IKK activity, and messenger RNA expression of TNF-alpha in MNCs in healthy subjects.
16756995 Surface plasmon resonance (SPR) data showed that the IkappaBalpha and NF-kappaB associate rapidly but dissociate very slowly, leading to an extremely stable complex.
16737960 TLR8-mediated MEKK3-dependent IKKgamma phosphorylation might play an important role in the activation of IKK complex, leading to IkappaBalpha phosphorylation
16540234 Observational study of gene-disease association. (HuGE Navigator)
16540234 Significant differences in the frequency of particular polymorphisms across the NFKBIA gene were noted between patients and controls, and analysis may lead to associations with disease progression and survival and thus more personalized therapy.
16429138 HIV-1 Tat degrades of NFKBIA (IKappaBalpha)) in CRT-MG human astroglioma cells
16426569 ST2 negatively regulates LPS-induced IL-6 production via the inhibition of IkappaB degradation in THP-1 cells
16407234 Herpes simplex virus disrupts NF-kappaB regulation by blocking its recruitment on the IkappaBalpha promoter
16258173 IkappaB kinase and IkappaBalpha have NF-kappaB-dependent as well as NF-kappaB-independent pathways of HAS1 activation
16105840 p65 phosphorylated on serine 536 is not associated with or regulated by IkappaBalpha, but it has a distinct set of target genes and may represent a noncanonical NF-kappaB pathway that is independent of IkappaBalpha regulation
16046415 Galpha13-induced VASP phosphorylation that involves activation of RhoA and MEKK1, phosphorylation and degradation of IkappaB, release of PKA catalytic subunit from the complex with IkappaB and NF-kappaB, and subsequent phosphorylation of VASP
16001969 HIV-1 Tat degrades of NFKBIA (IKappaBalpha)) in CRT-MG human astroglioma cells
15979856 IkappaB-alpha is involved in the proliferation of human Burkitt lymphoma Daudi cells, possibly through the MAP kinase pathway.
15858823 Observational study of gene-disease association. (HuGE Navigator)
15817944 HIV-1 Tat degrades of NFKBIA (IKappaBalpha)) in CRT-MG human astroglioma cells
15811852 gene transactivation by the transcription factor NF-kappaB is subject to the regulation of a dynamic balance between the coactivators and corepressors in the IkappaB alpha promoter
15725353 HIV-1 Tat degrades of NFKBIA (IKappaBalpha)) in CRT-MG human astroglioma cells
15671028 Results indicate that polymyxin B induces a partial maturation of human dendritic cells through increased adhesion and activation of the IkappaB-alpha/NF-kappaB pathway, and that increased ERK1/2 activation inhibits maturation.
15613239 IkappaB-alphaS32/36A, a proteolysis-resistant inhibitor of NF-kappaB, potently inhibits the growth of HIV-1 and SIVmac239 in cell cultures.
15536134 IkappaBalpha is recruited to the promoter regions of the Notch-target gene, hes1
15389633 demonstrated that TRAIL mediates the recruitment of PI-3K/Akt and NF-B/IB pathways in leukaemic cells, namely Jurkat T cells
15337789 IkappaBalpha mutation can result in different clinical syndromes within one family
15330761 results indicate that the PKC pathway leading to SOD2 induction proceeds at least in part through NF-kappaB and that inhibition of IkappaBalpha synthesis might serve as a potential pharmacological approach to up-regulate MnSOD
15202778 Calpain plays an important role in IkB alpha degradation, a crucial event in T cell activation.
15184376 IkappaBalpha is inhibited by ultraviolet rays and activates NFkappaB
15173174 I kappa B-NF kappa B participates on ERK2-mediated survival mechanisms
15142381 HIV-1 Tat degrades of NFKBIA (IKappaBalpha)) in CRT-MG human astroglioma cells
15103018 HIV-1 Tat degrades of NFKBIA (IKappaBalpha)) in CRT-MG human astroglioma cells
15073126 nuclear factor-kappa B and I kappa B alpha proteins have roles in development of prostatic adenocarcinomas
15068390 PCR measure of I kappa B-alpha mRNA levels is a rapid, sensitive, and powerful method to quantify the transcriptional power of NF-kappa B.
14961554 Observational study of gene-disease association. (HuGE Navigator)
14623898 Down-regulation of PTEN by NIK/NF-kappaB results in activation of the PI3K/Akt pathway. This effect is associated with a lack of an inhibitor of kappaB (IkappaB)-alpha autoregulatory loop.
14576361 IkappaBalpha was markedly degraded at 1 h, and NF-kappaB-DNA-binding activity markedly increased 2 h after beta(2) integrin aggregation
14561767 HIV-1 Tat degrades of NFKBIA (IKappaBalpha)) in CRT-MG human astroglioma cells
13680285 single nucleotide polymorphisms in the 3'-UTR were significantly increased only in Crohn's disease patients without a variation in the CARD15 gene.
12973300 HIV-1 Tat degrades of NFKBIA (IKappaBalpha)) in CRT-MG human astroglioma cells
12972430 IkappaBalpha regulates the transcriptional activity of homeodomain-containing proteins positively through cytoplasmic sequestration of HDAC1 and HDAC3
12944982 Inhibitor kappa B-alpha promoter polymorphisms is associated with pulmonary sarcoidosis
12921778 Okadaic acid induces degradation of the nuclear IKBA in neutrophils.
12897149 IKBA is degraded by HSP27 through the 26s proteasome
12748192 results indicate that protein kinase CKII may control IkappaBalpha and p27Kip1 degradation and thereby G1/S phase transition through the phosphorylation of threonine 10 within CKBBP1 protein
12711606 H2O2 induces NF-kappaB activation, not through serine phosphorylation or degradation of IkappaBalpha, but through Syk-mediated tyrosine phosphorylation of IkappaBalpha
12704657 Induced stabilization of IkappaBalpha can facilitate its re-synthesis and prevent sequential degradation.
12651903 Data show that increased nuclear factor-kappaB (NF-kB) activity in the amnion during labor is associated with an increase in the expression of NF-kBp65 and of the NF-kB binding proteins IkBa, IkBb-1 and IkBb-2.
12620896 data suggest that NO may play a major role in the regulation of IkappaBalpha levels in aortic endothelial cells and that the application of low shear flow increases NF-kappaB activity by attenuating NO generation and thus IkappaBalpha levels.
12589049 IkappaBalpha and p65 have roles in regulating the cytoplasmic shuttling of nuclear corepressors
12518988 Our data suggest that the serine and tyrosine phosphorylation of IkappaB-alpha may play a role in determining the radiosensitivity of malignant glioma cells.
12433922 found in mitochondria; regulates mitochondrial gene expression
12419806 IkappaBalpha attenuates NF-kappaBeta transcriptional activity which is an important process that restores the latent state in post-induced cells
12419805 HIV-1 Tat degrades of NFKBIA (IKappaBalpha)) in CRT-MG human astroglioma cells
12406554 Observational study of gene-disease association. (HuGE Navigator)
12388747 These data suggest that the subcellular location of I(kappa)B(alpha) is a critical determinant in ionizing radiation-induced nuclear factor-kappaB activation.
12377412 polymorphism associated with an increased risk of multiple myeloma
12297126 NFkB, I-kB and I-kB kinase are present in platelets; upon platelet activation, the NF-kappaB/I-kappaBalpha complex is dissociated by phosphorylation of I-kB and proteolysis.
12244195 Increased nuclear accumulation of I kappa B alpha in neutrophils is associated with the inhibition of NF-kappa B activity and the induction of apoptosis in these cells.
12193729 A membrane-transducing mutant of I kappa B alpha has been generated that efficiently enters cells, associates with NF-kappa B p65 subunit, and inhibits NF-kappa B-mediated transcription and binding to its consensus sequence.
12167702 The protein IkappaBalpha is a novel substrate of recombinant c-Abl in HEK cells. c-Abl-mediated phosphorylation at tyrosine 305 is associated with an increase of the IkappaBalpha protein stability.
12086926 Lipid-induced insulin resistance in human muscle is associated with changes in diacylglycerol, protein kinase C and Ikappab-alpha
12084717 results demonstrate that SLPI prevents LPS-induced NF-kappaB activation by inhibiting degradation of IkappaBalpha without affecting the LPS-induced phosphorylation and ubiquitination of IkappaBalpha
12028809 NF-kappa Beta activation in BAL cells may play in important role in initiation and progression of silica-induced pulmonary inflammation, cellular damage, and fibrosis
11959143 HIV-1 Tat degrades of NFKBIA (IKappaBalpha)) in CRT-MG human astroglioma cells
11913973 A novel in vitro assay for deubiquitination of I kappa B alpha
11799106 IkappaBalpha x p53 complex plays an important role in responses involving growth regulation, apoptosis, and hypoxic stress
11696595 HIV-1 Tat degrades of NFKBIA (IKappaBalpha)) in CRT-MG human astroglioma cells
11511100 HIV-1 Tat degrades of NFKBIA (IKappaBalpha)) in CRT-MG human astroglioma cells
11278695 HIV-1 Tat degrades of NFKBIA (IKappaBalpha)) in CRT-MG human astroglioma cells
10580107 HIV-1 Tat degrades of NFKBIA (IKappaBalpha)) in CRT-MG human astroglioma cells
10480634 HIV-1 Tat degrades of NFKBIA (IKappaBalpha)) in CRT-MG human astroglioma cells
10393859 HIV-1 Tat degrades of NFKBIA (IKappaBalpha)) in CRT-MG human astroglioma cells
9334723 HIV-1 Tat degrades of NFKBIA (IKappaBalpha)) in CRT-MG human astroglioma cells
9060679 HIV-1 Tat degrades of NFKBIA (IKappaBalpha)) in CRT-MG human astroglioma cells
8709193 HIV-1 Tat degrades of NFKBIA (IKappaBalpha)) in CRT-MG human astroglioma cells
8615004 HIV-1 Tat degrades of NFKBIA (IKappaBalpha)) in CRT-MG human astroglioma cells
7878004 HIV-1 Tat degrades of NFKBIA (IKappaBalpha)) in CRT-MG human astroglioma cells
7565415 HIV-1 Tat degrades of NFKBIA (IKappaBalpha)) in CRT-MG human astroglioma cells

AA Sequence

MFQAAERPQEWAMEGPRDGLKKERLLDDRHDSGLDSMKDEEYEQMVKELQEIRLEPQEVPRGSEPWKQQL      1 - 70
TEDGDSFLHLAIIHEEKALTMEVIRQVKGDLAFLNFQNNLQQTPLHLAVITNQPEIAEALLGAGCDPELR     71 - 140
DFRGNTPLHLACEQGCLASVGVLTQSCTTPHLHSILKATNYNGHTCLHLASIHGYLGIVELLVSLGADVN    141 - 210
AQEPCNGRTALHLAVDLQNPDLVSLLLKCGADVNRVTYQGYSPYQLTWGRPSTRIQQQLGQLTLENLQML    211 - 280
PESEDEESYDTESEFTEFTEDELPYDDCVFGGQRLTL                                     281 - 317
//

Text Mined References (373)

PMID Year Title
27151455 2016 Activated Rac1 regulates the degradation of I?B? and the nuclear translocation of STAT3-NF?B complexes in starved cancer cells.
26691317 2016 Severe Mycobacterial Diseases in a Patient with GOF I?B? Mutation Without EDA.
26647777 2016 Diallyl trisulfide induces apoptosis by suppressing NF-?B signaling through destabilization of TRAF6 in primary effusion lymphoma.
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
26488500 2015 Common Polymorphisms in the NFKBIA Gene and Cancer Susceptibility: A Meta-Analysis.
26477820 2015 Associations between single nucleotide polymorphisms in the FAS pathway and acute kidney injury.
26295305 2015 Non genomic loss of function of tumor suppressors in CML: BCR-ABL promotes I?B? mediated p53 nuclear exclusion.
26252270 2015 Genetic Association Between NFKBIA -881A>G Polymorphism and Cancer Susceptibility.
26239140 2015 MicroRNA-19a mediates gastric carcinoma cell proliferation through the activation of nuclear factor-?B.
26161396 2015 Polymorphisms of NF?B1 and I?B? and Their Synergistic Effect on Nasopharyngeal Carcinoma Susceptibility.
26075620 2015 Genetic Variation in NFKB1 and NFKBIA and Susceptibility to Coronary Artery Disease in a Chinese Uygur Population.
26068031 2015 Polymorphisms in NFKB1 and NFKBIA Genes Modulate the Risk of Developing Prostate Cancer among Han Chinese.
25974152 2015 Upregulation of microRNA-126 in hepatic stellate cells may affect pathogenesis of liver fibrosis through the NF-?B pathway.
25937534 2015 SM22? inhibits vascular inflammation via stabilization of I?B? in vascular smooth muscle cells.
25930675 2015 Human renal carcinoma cells respond to Newcastle disease virus infection through activation of the p38 MAPK/NF-?B/I?B? pathway.
25759022 2015 A cytoplasmic NF-?B interacting long noncoding RNA blocks I?B phosphorylation and suppresses breast cancer metastasis.
25609694 2015 ZBTB2 increases PDK4 expression by transcriptional repression of RelA/p65.
25609649 2015 Proteomic analyses reveal distinct chromatin-associated and soluble transcription factor complexes.
25577468 2015 Luteolin protects against vascular inflammation in mice and TNF-alpha-induced monocyte adhesion to endothelial cells via suppressing I?B?/NF-?B signaling pathway.
25416956 2014 A proteome-scale map of the human interactome network.
25374080 2014 [Expression of I?B? in bladder cancer cell lines is negatively correlated with epithelial-mesenchymal transition and cell invasion in vitro].
25367031 2015 Association of NFKB1 and NFKBIA polymorphisms in relation to susceptibility of Behçet's disease.
25361605 2014 I??? inhibits apoptosis at the outer mitochondrial membrane independently of NF-?B retention.
25352423 2015 Smoking attenuated the association between I?B? rs696 polymorphism and defective spermatogenesis in humans.
25326706 2014 Genetic polymorphisms and risk of recurrent wheezing in pediatric age.
25215581 2014 Identification of a NFKBIA polymorphism associated with lower NFKBIA protein levels and poor survival outcomes in patients with glioblastoma multiforme.
25112903 2014 Polymorphism in NFKBIA gene is associated with recurrent acute rejections in liver transplant recipients.
24973451 2014 Dengue viral protease interaction with NF-?B inhibitor ?/? results in endothelial cell apoptosis and hemorrhage development.
24634218 2014 Krüppel-like factor 6 is a co-activator of NF-?B that mediates p65-dependent transcription of selected downstream genes.
24578542 2014 Genetic polymorphism of NFKB1 and NFKBIA genes and liver cancer risk: a nested case-control study in Shanghai, China.
24504166 2014 MiR-196a promotes pancreatic cancer progression by targeting nuclear factor kappa-B-inhibitor alpha.
24463357 2014 MiR-196a exerts its oncogenic effect in glioblastoma multiforme by inhibition of I?B? both in vitro and in vivo.
24457201 2014 Ribosomal protein S3 interacts with the NF-?B inhibitor I?B?.
24368589 2014 Inhibitor I?B? promoter functional polymorphisms in patients with multiple sclerosis.
24367071 2014 Direct observation of a transient ternary complex during I?B?-mediated dissociation of NF-?B from DNA.
24361600 2014 Prodegenerative I?B? expression in oligodendroglial ?-synuclein models of multiple system atrophy.
24330732 2013 Frequency of NFKBIA deletions is low in glioblastomas and skewed in glioblastoma neurospheres.
24324738 2013 Association of common polymorphisms in TNFA, NFkB1 and NFKBIA with risk and prognosis of esophageal squamous cell carcinoma.
24295474 Intracellular NF-kB-decrease and IKB? increase in human macrophages following CTLA4-Ig treatment.
24248593 2014 The p97-UFD1L-NPL4 protein complex mediates cytokine-induced I?B? proteolysis.
24085292 2013 Long-term incubation with proteasome inhibitors (PIs) induces I?B? degradation via the lysosomal pathway in an I?B kinase (IKK)-dependent and IKK-independent manner.
23996241 2013 Gender-specific association of NFKBIA promoter polymorphisms with the risk of sporadic colorectal cancer.
23850221 2013 Chromatin-bound I?B? regulates a subset of polycomb target genes in differentiation and cancer.
23697845 2014 Bortezomib inhibits proteasomal degradation of I?B? and induces mitochondrial dependent apoptosis in activated B-cell diffuse large B-cell lymphoma.
23675531 2013 DDRGK1 regulates NF-?B activity by modulating I?B? stability.
23602409 2013 A NIK-IKK? module expands ErbB2-induced tumor-initiating cells by stimulating nuclear export of p27/Kip1.
23563313 2013 CCDC22 deficiency in humans blunts activation of proinflammatory NF-?B signaling.
23555990 2013 Phosphorylated I?B? predicts poor prognosis in activated B-cell lymphoma and its inhibition with thymoquinone induces apoptosis via ROS release.
23487427 2013 Functional genetic variation in NFKBIA and susceptibility to childhood asthma, bronchiolitis, and bronchopulmonary dysplasia.
23469069 2013 In silico structural and functional characterization of the RSUME splice variants.
23457512 2013 Effects of NFKB1 and NFKBIA gene polymorphisms on hepatocellular carcinoma susceptibility and clinicopathological features.
23453579 2013 HIV-1 Vpr activates both canonical and noncanonical NF-?B pathway by enhancing the phosphorylation of IKK?/?.
23439505 2013 Silenced expression of NFKBIA in lung adenocarcinoma patients with a never-smoking history.
23422506 2013 Mu-opioid signaling modulates biphasic expression of TrkB and I?B? genes and neurite outgrowth in differentiating and differentiated human neuroblastoma cells.
23377923 2013 Salivary gland expression level of I?B? regulatory protein in Sjögren's syndrome.
23322360 2013 Functional polymorphisms in NF?B1/I?B? predict risks of chronic obstructive pulmonary disease and lung cancer in Chinese.
23285182 2012 Up-regulation of microRNA-126 may contribute to pathogenesis of ulcerative colitis via regulating NF-kappaB inhibitor I?B?.
23274114 2013 Long-range effects and functional consequences of stabilizing mutations in the ankyrin repeat domain of I?B?.
23250755 2013 Phosphorylation of I?B? at serine 32 by T-lymphokine-activated killer cell-originated protein kinase is essential for chemoresistance against doxorubicin in cervical cancer cells.
23069812 2013 EMT and CSC-like properties mediated by the IKK?/I?B?/RelA signal pathway via the transcriptional regulator, Snail, are involved in the arsenite-induced neoplastic transformation of human keratinocytes.
23054188 2013 Homeostatic regulatory role of Pokemon in NF-?B signaling: stimulating both p65 and I?B? expression in human hepatocellular carcinoma cells.
23046941 2012 [Expressions of NF-?Bp65 and I?B? in gestational trophoblastic disease and clinical significance].
22935973 2012 Altered I?B? expression promotes NF-?B activation in monocytes from primary Sjögren's syndrome patients.
22509384 2012 Effects of NFKB1 and NFKBIA gene polymorphisms on susceptibility to environmental factors and the clinicopathologic development of oral cancer.
22393418 2012 Blocking autophagy prevents bortezomib-induced NF-?B activation by reducing I-?B? degradation in lymphoma cells.
22302838 2012 Blockade of the nuclear factor-?B pathway in the endothelium prevents insulin resistance and prolongs life spans.
22184009 2012 The E3 ubiquitin ligase MIB1 negatively regulates basal I?B? level and modulates NF-?B activation.
22156201 2012 MicroRNA-30e* promotes human glioma cell invasiveness in an orthotopic xenotransplantation model by disrupting the NF-?B/I?B? negative feedback loop.
22078572 2012 A rapid screening method to detect autosomal-dominant ectodermal dysplasia with immune deficiency syndrome.
22037600 2011 The I?B kinase complex regulates the stability of cytokine-encoding mRNA induced by TLR-IL-1R by controlling degradation of regnase-1.
22022389 2011 Role of monoubiquitylation on the control of I?B? degradation and NF-?B activity.
22014111 2011 Flavivirus NS3 and NS5 proteins interaction network: a high-throughput yeast two-hybrid screen.
21988832 2011 Toward an understanding of the protein interaction network of the human liver.
21778941 2011 Alteration in NFKBIA and EGFR in glioblastoma multiforme.
21765415 2011 The kinase IKK? inhibits activation of the transcription factor NF-?B by phosphorylating the regulatory molecule TAX1BP1.
21606193 2011 Exogenous signal-independent nuclear IkappaB kinase activation triggered by Nkx3.2 enables constitutive nuclear degradation of IkappaB-alpha in chondrocytes.
21454528 2011 GLI2 transcription factor mediates cytokine cross-talk in the tumor microenvironment.
21399639 2011 IKK? phosphorylation regulates RPS3 nuclear translocation and NF-?B function during infection with Escherichia coli strain O157:H7.
21376060 2011 I?B? polymorphisms were associated with increased risk of gastric cancer in a southern Chinese population: a case-control study.
21263074 2011 HIV replication in CD4+ T lymphocytes in the presence and absence of follicular dendritic cells: inhibition of replication mediated by ?-1-antitrypsin through altered I?B? ubiquitination.
21228035 2011 Polymorphisms of nuclear factor-?B family genes are associated with development of multiple myeloma and treatment outcome in patients receiving bortezomib-based regimens.
21220295 2011 Detection of a ternary complex of NF-kappaB and IkappaBalpha with DNA provides insights into how IkappaBalpha removes NF-kappaB from transcription sites.
21217772 2011 Glycogen synthase kinase-3? is a crucial mediator of signal-induced RelB degradation.
21175304 2011 NFKBIA deletion in glioblastomas.
21048031 2011 Single nucleotide polymorphisms of matrix metalloproteinase 9 (MMP9) and tumor protein 73 (TP73) interact with Epstein-Barr virus in chronic lymphocytic leukemia: results from the European case-control study EpiLymph.
20953190 2010 A genome-wide association study identifies new psoriasis susceptibility loci and an interaction between HLA-C and ERAP1.
20953189 2010 Genome-wide association analysis identifies three psoriasis susceptibility loci.
20890592 2011 Acrolein, an I-?B?-independent downregulator of NF-?B activity, causes the decrease in nitric oxide production in human malignant keratinocytes.
20836841 2010 Polymorphisms in NFkB, PXR, LXR and risk of colorectal cancer in a prospective study of Danes.
20811626 2010 Genetic variants in inflammation-related genes are associated with radiation-induced toxicity following treatment for non-small cell lung cancer.
20797629 2010 Nuclear IKKbeta is an adaptor protein for IkappaBalpha ubiquitination and degradation in UV-induced NF-kappaB activation.
20716621 2010 Genetic polymorphisms in adaptive immunity genes and childhood acute lymphoblastic leukemia.
20696864 2010 Gene-specific repression of proinflammatory cytokines in stimulated human macrophages by nuclear I?B?.
20674643 2010 Association of IKBA gene polymorphisms with the development of asthma.
20659425 2010 I-kappaBalpha depletion by transglutaminase 2 and mu-calpain occurs in parallel with the ubiquitin-proteasome pathway.
20652762 2010 Alpha-mangostin suppresses phorbol 12-myristate 13-acetate-induced MMP-2/MMP-9 expressions via alphavbeta3 integrin/FAK/ERK and NF-kappaB signaling pathway in human lung adenocarcinoma A549 cells.
20628624 2010 Evaluation of candidate stromal epithelial cross-talk genes identifies association between risk of serous ovarian cancer and TERT, a cancer susceptibility "hot-spot".
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20568250 2010 Common single nucleotide polymorphisms in immunoregulatory genes and multiple myeloma risk among women in Connecticut.
20563630 2010 Inhibitor IkappaBalpha promoter functional polymorphisms in patients with rheumatoid arthritis.
20546338 2010 Expression of classical NF-kappaB pathway effectors in human ovarian carcinoma.
20504922 2010 The cysteine protease domain of porcine reproductive and respiratory syndrome virus nonstructural protein 2 possesses deubiquitinating and interferon antagonism functions.
20503287 2010 Interleukin-9 polymorphism in infants with respiratory syncytial virus infection: an opposite effect in boys and girls.
20495844 2011 Association of the NFKBIA gene polymorphisms with susceptibility to autoimmune and inflammatory diseases: a meta-analysis.
20453000 2010 A Large-scale genetic association study of esophageal adenocarcinoma risk.
20448286 2010 Association between anti-tumour necrosis factor treatment response and genetic variants within the TLR and NF{kappa}B signalling pathways.
20388715 2010 Inflammation anergy in human intestinal macrophages is due to Smad-induced IkappaBalpha expression and NF-kappaB inactivation.
20385620 2010 RSK2 mediates NF-{kappa}B activity through the phosphorylation of IkappaBalpha in the TNF-R1 pathway.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20379146 2010 Biological pathway-based genome-wide association analysis identified the vasoactive intestinal peptide (VIP) pathway important for obesity.
20356841 2010 Thrombin and collagen induce a feedback inhibitory signaling pathway in platelets involving dissociation of the catalytic subunit of protein kinase A from an NFkappaB-IkappaB complex.
20347421 2010 Priming and extending: a UbcH5/Cdc34 E2 handoff mechanism for polyubiquitination on a SCF substrate.
20335171 2010 Proteasome inhibitor PS-341 (bortezomib) induces calpain-dependent IkappaB(alpha) degradation.
20304615 2011 -94 ins/del ATTG NFKB1 gene variant is associated with lower susceptibility to myocardial infarction.
20193848 2010 Mutations of NFKBIA in biopsy specimens from Hodgkin lymphoma.
20164548 2010 IkappaBalpha promoter polymorphisms in patients with Behçet's disease.
20132559 2010 IkappaBalpha polymorphism at promoter region (rs2233408) influences the susceptibility of gastric cancer in Chinese.
20080849 2010 Growth hormone and insulin-like growth factor I insensitivity of fibroblasts isolated from a patient with an I{kappa}B{alpha} mutation.
20068069 2010 Clusterin facilitates COMMD1 and I-kappaB degradation to enhance NF-kappaB activity in prostate cancer cells.
20056178 2010 Polymorphisms in innate immunity genes and patients response to dendritic cell-based HIV immuno-treatment.
19948975 2009 Integrative predictive model of coronary artery calcification in atherosclerosis.
19941056 2010 Identification of NF-kappaB1 and NF-kappaBIAlpha polymorphisms using PCR-RFLP assay in a Turkish population.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19891769 2009 Aurora-A down-regulates IkappaBalpha via Akt activation and interacts with insulin-like growth factor-1 induced phosphatidylinositol 3-kinase pathway for cancer cell survival.
19886988 2009 Association of polymorphism in genes encoding kappaB inhibitors (IkappaB) with susceptibility to and phenotype of Graves' disease: a case-control study.
19879840 2009 Beta-arrestin1 regulates zebrafish hematopoiesis through binding to YY1 and relieving polycomb group repression.
19816602 2009 Suppression of IkappaBalpha increases the expression of matrix metalloproteinase-2 in human ciliary muscle cells.
19798070 2010 Variant in the 3' region of the IkappaBalpha gene associated with insulin resistance in Hispanic Americans: The IRAS Family Study.
19797428 2009 IkappaBalpha gene promoter polymorphisms are associated with hepatocarcinogenesis in patients infected with hepatitis B virus genotype C.
19773451 2009 Role of inflammation gene polymorphisms on pain severity in lung cancer patients.
19773279 2009 Association between genetic variants in VEGF, ERCC3 and occupational benzene haematotoxicity.
19758175 2009 Distribution of the NF-kappaB complex in the inflammatory exudates characterizing the idiopathic inflammatory myopathies.
19733238 2009 C/EBPbeta enhances NF-kappaB-associated signalling by reducing the level of IkappaB-alpha.
19673747 2009 A functional polymorphism of the NFKB1 gene increases the risk for alcoholic liver cirrhosis in patients with alcohol dependence.
19648161 2010 Mutations in the genes coding for the NF-?B regulating factors I?B? and A20 are uncommon in nodular lymphocyte-predominant Hodgkin's lymphoma.
19591507 2009 Functional dynamics of the folded ankyrin repeats of I kappa B alpha revealed by nuclear magnetic resonance.
19573080 2009 Common genetic variants in candidate genes and risk of familial lymphoid malignancies.
19554506 2009 Expression of eight genes of nuclear factor-kappa B pathway in multiple myeloma using bone marrow aspirates obtained at diagnosis.
19543524 2009 20-Hydroxycholecalciferol, product of vitamin D3 hydroxylation by P450scc, decreases NF-kappaB activity by increasing IkappaB alpha levels in human keratinocytes.
19527514 2009 Racial disparity in pathophysiologic pathways of preterm birth based on genetic variants.
19522780 2009 Transgenic inhibition of astroglial NF-kappa B leads to increased axonal sparing and sprouting following spinal cord injury.
19507254 2009 Mutations of NFKBIA, encoding IkappaB alpha, are a recurrent finding in classical Hodgkin lymphoma but are not a unifying feature of non-EBV-associated cases.
19500386 2009 Polymorphisms in NF-kappaB inhibitors and risk of epithelial ovarian cancer.
19456861 2009 Inhibitor of nuclear factor-kappaB alpha derepresses hypoxia-inducible factor-1 during moderate hypoxia by sequestering factor inhibiting hypoxia-inducible factor from hypoxia-inducible factor 1alpha.
19453261 2009 High-density association study of 383 candidate genes for volumetric BMD at the femoral neck and lumbar spine among older men.
19363678 2009 IkB? promoter polymorphisms in patients with ankylosing spondylitis.
19345327 2009 Persistently activated Stat3 maintains constitutive NF-kappaB activity in tumors.
19297320 2009 Adenosine signaling mediates SUMO-1 modification of IkappaBalpha during hypoxia and reoxygenation.
19296948 2009 Immunoreactivity of progesterone receptor isoform B, nuclear factor kappaB, and IkappaBalpha in adenomyosis.
19258923 2009 Genetic susceptibility to respiratory syncytial virus bronchiolitis in preterm children is associated with airway remodeling genes and innate immune genes.
19245366 2009 MYPT1, the targeting subunit of smooth-muscle myosin phosphatase, is a substrate for the asparaginyl hydroxylase factor inhibiting hypoxia-inducible factor (FIH).
19223558 2009 Polymorphic variation in NFKB1 and other aspirin-related genes and risk of Hodgkin lymphoma.
19213954 2009 The orphan nuclear receptor Nur77 suppresses endothelial cell activation through induction of IkappaBalpha expression.
19187648 2009 The regulating role of mutant IkappaBalpha in expression of TIMP-2 and MMP-9 in human glioblastoma multiform.
19046417 2008 Caspase-3-mediated cleavage of p65/RelA results in a carboxy-terminal fragment that inhibits IkappaBalpha and enhances HIV-1 replication in human T lymphocytes.
19019440 2009 C-mip interacts physically with RelA and inhibits nuclear factor kappa B activity.
18981184 2009 Tumor suppressor SMAR1 represses IkappaBalpha expression and inhibits p65 transactivation through matrix attachment regions.
18950845 2009 Evaluating new candidate SNPs as low penetrance risk factors in sporadic breast cancer: a two-stage Spanish case-control study.
18922877 2008 Measles virus V protein is a decoy substrate for IkappaB kinase alpha and prevents Toll-like receptor 7/9-mediated interferon induction.
18818748 2008 Preterm birth in Caucasians is associated with coagulation and inflammation pathway gene variants.
18716880 2009 The 3'UTR NFKBIA variant is associated with extensive colitis in Hungarian IBD patients.
18660489 2008 Multiple genetic variants along candidate pathways influence plasma high-density lipoprotein cholesterol concentrations.
18636537 2008 Blockage of NF-kappaB by IKKbeta- or RelA-siRNA rather than the NF-kappaB super-suppressor IkappaBalpha mutant potentiates adriamycin-induced cytotoxicity in lung cancer cells.
18636124 2008 Polymorphisms in the estrogen receptor 1 and vitamin C and matrix metalloproteinase gene families are associated with susceptibility to lymphoma.
18606063 2008 [Inhibition of NF-kappaB through IkappaBalpha transfection affects invasion of human lung cancer cell line A549].
18600435 2008 IkappaBalpha promoter polymorphisms in patients with primary Sjögren's syndrome.
18577712 2008 The familial Mediterranean fever protein, pyrin, is cleaved by caspase-1 and activates NF-kappaB through its N-terminal fragment.
18555796 2008 Glutathionylation regulates IkappaB.
18539148 2008 HSV-1 ICP27 suppresses NF-kappaB activity by stabilizing IkappaBalpha.
18515365 2008 Interleukin (IL) 1beta induction of IL-6 is mediated by a novel phosphatidylinositol 3-kinase-dependent AKT/IkappaB kinase alpha pathway targeting activator protein-1.
18511071 2008 Pre-folding IkappaBalpha alters control of NF-kappaB signaling.
18474597 2008 Hydrogen peroxide prolongs nuclear localization of NF-kappaB in activated cells by suppressing negative regulatory mechanisms.
18434448 2009 Genetic variation in the nuclear factor kappaB pathway in relation to susceptibility to rheumatoid arthritis.
18412279 2008 A novel mutation in NFKBIA/IKBA results in a degradation-resistant N-truncated protein and is associated with ectodermal dysplasia with immunodeficiency.
18356846 2008 Effect of weight loss on proinflammatory state of mononuclear cells in obese women.
18260825 2008 Interleukin-1beta up-regulates RGS4 through the canonical IKK2/IkappaBalpha/NF-kappaB pathway in rabbit colonic smooth muscle.
18215193 2008 Potential biomarkers involving IKK/RelA signal in early stage non-small cell lung cancer.
18199400 2008 [Evaluation of nuclear factor-KappaB and I Kappa B mRNA expression in determining the prognosis of multiple organ dysfunction syndrome].
18071880 2008 I kappa B alpha promoter polymorphisms in patients with systemic lupus erythematosus.
18045535 2007 Ribosomal protein S3: a KH domain subunit in NF-kappaB complexes that mediates selective gene regulation.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17991436 2007 Hypo-phosphorylation leads to nuclear retention of NF-kappaB p65 due to impaired IkappaBalpha gene synthesis.
17956732 2007 RSUME, a small RWD-containing protein, enhances SUMO conjugation and stabilizes HIF-1alpha during hypoxia.
17942396 2007 IkappaB-alpha represses the transcriptional activity of the HIV-1 Tat transactivator by promoting its nuclear export.
17910475 2007 Tyrosine nitration of IkappaBalpha: a novel mechanism for NF-kappaB activation.
17703412 2007 Genetic susceptibility to respiratory syncytial virus bronchiolitis is predominantly associated with innate immune genes.
17701919 2007 NFKB and NFKBI polymorphisms in relation to susceptibility of tumour and other diseases.
17681786 2007 Berberine suppresses inflammatory agents-induced interleukin-1beta and tumor necrosis factor-alpha productions via the inhibition of IkappaB degradation in human lung cells.
17612295 2007 Yeast split-ubiquitin-based cytosolic screening system to detect interactions between transcriptionally active proteins.
17607549 2007 Hyaluronan inhibits cytokine production by lipopolysaccharide-stimulated U937 macrophages through down-regulation of NF-kappaB via ICAM-1.
17593226 2007 Polymorphisms in NFKBIA and ICAM-1 genes in New Zealand Caucasian Crohn's disease patients.
17492467 2007 Importance of polymorphisms in NF-kappaB1 and NF-kappaBIalpha genes for melanoma risk, clinicopathological features and tumor progression in Swedish melanoma patients.
17463416 2007 IkappaB genetic polymorphisms and invasive pneumococcal disease.
17354114 2007 Association of NFKBIA polymorphism with colorectal cancer risk and prognosis in Swedish and Chinese populations.
17351338 2007 Inhibitor of NF kappa B alpha is a host sensor of coxsackievirus infection.
17333217 2007 Lack of association of the 3'-UTR polymorphism in the NFKBIA gene with Crohn's disease in an Israeli cohort.
17318773 2007 HLA, NFKB1 and NFKBIA gene polymorphism profile in autoimmune diabetes mellitus patients.
17318178 2007 CSN controls NF-kappaB by deubiquitinylation of IkappaBalpha.
17316064 Mechanisms of microvascular wound repair I. Role of mitosis, oxygen tension, and I-kappa B.
17307728 2007 Developmentally regulated tumor necrosis factor-alpha induced nuclear factor-kappaB activation in intestinal epithelium.
17284228 2007 IkappaBalpha promoter polymorphisms in patients with rheumatoid arthritis.
17148610 2006 Regions of IkappaBalpha that are critical for its inhibition of NF-kappaB.DNA interaction fold upon binding to NF-kappaB.
17115186 2007 TagSNP evaluation for the association of 42 inflammation loci and vascular disease: evidence of IL6, FGB, ALOX5, NFKBIA, and IL4R loci effects.
17062574 2006 Down syndrome candidate region 1 increases the stability of the IkappaBalpha protein: implications for its anti-inflammatory effects.
17003112 2006 Posttranslational hydroxylation of ankyrin repeats in IkappaB proteins by the hypoxia-inducible factor (HIF) asparaginyl hydroxylase, factor inhibiting HIF (FIH).
16997282 2006 NF-kappaB functions in the nervous system: from development to disease.
16955245 2006 Mechanism and function of heat shock-dependent IkappaBalpha expression.
16951195 2006 Overexpression of tissue transglutaminase leads to constitutive activation of nuclear factor-kappaB in cancer cells: delineation of a novel pathway.
16938301 2007 Macrophage-specific inhibition of NF-kappaB activation reduces foam-cell formation.
16931600 2006 Efficient nuclear export of p65-IkappaBalpha complexes requires 14-3-3 proteins.
16919536 2006 Glucose ingestion induces an increase in intranuclear nuclear factor kappaB, a fall in cellular inhibitor kappaB, and an increase in tumor necrosis factor alpha messenger RNA by mononuclear cells in healthy human subjects.
16756995 2006 Thermodynamics reveal that helix four in the NLS of NF-kappaB p65 anchors IkappaBalpha, forming a very stable complex.
16750872 2006 Influence of hypothermia on post-ischemic inflammation: role of nuclear factor kappa B (NFkappaB).
16737960 2006 TLR8-mediated NF-kappaB and JNK activation are TAK1-independent and MEKK3-dependent.
16683270 2006 NF-kappaB activation upregulates fibroblast growth factor 8 expression in prostate cancer cells.
16648481 2006 Protein methyltransferase 2 inhibits NF-kappaB function and promotes apoptosis.
16540234 2007 Haplotypic structure across the I kappa B alpha gene (NFKBIA) and association with multiple myeloma.
16426569 2006 ST2 suppresses IL-6 production via the inhibition of IkappaB degradation induced by the LPS signal in THP-1 cells.
16407234 2006 Herpes simplex virus disrupts NF-kappaB regulation by blocking its recruitment on the IkappaBalpha promoter and directing the factor on viral genes.
16365431 2006 Modulation of TLR4 signaling by a novel adaptor protein signal-transducing adaptor protein-2 in macrophages.
16319058 2006 Binding of manumycin A inhibits IkappaB kinase beta activity.
16291755 2006 The tyrosine kinase Syk regulates TPL2 activation signals.
16286467 2006 Interleukin-1beta induction of NFkappaB is partially regulated by H2O2-mediated activation of NFkappaB-inducing kinase.
16258173 2005 Adenovirus-mediated gene transfer of mutated IkappaB kinase and IkappaBalpha reveal NF-kappaB-dependent as well as NF-kappaB-independent pathways of HAS1 activation.
16195219 2005 Inhibition of SRC tyrosine kinases suppresses activation of nuclear factor-kappaB, and serine and tyrosine phosphorylation of IkappaB-alpha in lipopolysaccharide-stimulated raw 264.7 macrophages.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
16126728 2005 Positive regulation of IkappaB kinase signaling by protein serine/threonine phosphatase 2A.
16105840 2005 Phosphorylation of RelA/p65 on serine 536 defines an I{kappa}B{alpha}-independent NF-{kappa}B pathway.
16046415 2005 A novel mechanism of G protein-dependent phosphorylation of vasodilator-stimulated phosphoprotein.
15979856 2005 Relationship between constitutive nuclear factor-kappaB (NF-kappaB) and inhibitor kappaB-alpha (IkappaB-alpha) in an interferon-alpha-sensitive human Burkitt lymphoma cell line.
15858823 2005 Germline mutations and polymorphisms in the NFKBIA gene in Hodgkin lymphoma.
15811852 2005 Coactivators and corepressors of NF-kappaB in IkappaB alpha gene promoter.
15799966 2005 COMMD proteins, a novel family of structural and functional homologs of MURR1.
15671028 2005 Direct effects of polymyxin B on human dendritic cells maturation. The role of IkappaB-alpha/NF-kappaB and ERK1/2 pathways and adhesion.
15613239 2004 Inhibition of HIV-1 replication in primary human monocytes by the IkappaB-alphaS32/36A repressor of NF-kappaB.
15601829 2005 Molecular mechanism of hTid-1, the human homolog of Drosophila tumor suppressor l(2)Tid, in the regulation of NF-kappaB activity and suppression of tumor growth.
15536134 2004 Recruitment of IkappaBalpha to the hes1 promoter is associated with transcriptional repression.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15389633 2005 PI-3K/Akt and NF-kappaB/IkappaBalpha pathways are activated in Jurkat T cells in response to TRAIL treatment.
15389589 2005 Alpha-interferon and its effects on signal transduction pathways.
15337789 2004 The same IkappaBalpha mutation in two related individuals leads to completely different clinical syndromes.
15330761 2004 IkappaBalpha (inhibitory kappaBalpha) identified as labile repressor of MnSOD (manganese superoxide dismutase) expression.
15276183 2004 MD-2: the Toll 'gatekeeper' in endotoxin signalling.
15247916 2004 A functional variant of SUMO4, a new I kappa B alpha modifier, is associated with type 1 diabetes.
15202778 2004 The effects of calpain inhibition on IkB alpha degradation after activation of PBMCs: identification of the calpain cleavage sites.
15184376 2004 Ultraviolet light activates NFkappaB through translational inhibition of IkappaBalpha synthesis.
15173174 2004 Subcellular localization determines the protective effects of activated ERK2 against distinct apoptogenic stimuli in myeloid leukemia cells.
15161102 2004 A conserved non-homeodomain Hoxa9 isoform interacting with CBP is co-expressed with the 'typical' Hoxa9 protein during embryogenesis.
15125834 2004 Identification of beta-arrestin2 as a G protein-coupled receptor-stimulated regulator of NF-kappaB pathways.
15073126 2004 Expression of nuclear factor-kappa B and I kappa B alpha proteins in prostatic adenocarcinomas: correlation of nuclear factor-kappa B immunoreactivity with disease recurrence.
15068390 2003 Monitoring NF-kappa B transactivation potential via real-time PCR quantification of I kappa B-alpha gene expression.
14961554 2003 Identification of variants in NFKBIA and association analysis with hepatocellular carcinoma risk among chronic HBV patients.
14743216 2004 A physical and functional map of the human TNF-alpha/NF-kappa B signal transduction pathway.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14685242 2003 The gene product Murr1 restricts HIV-1 replication in resting CD4+ lymphocytes.
14623898 2004 Down-regulation of the tumor suppressor PTEN by the tumor necrosis factor-alpha/nuclear factor-kappaB (NF-kappaB)-inducing kinase/NF-kappaB pathway is linked to a default IkappaB-alpha autoregulatory loop.
14576361 2004 Aggregation of beta2 integrins activates human neutrophils through the IkappaB/NF-kappaB pathway.
14561767 2004 HIV-1 Vpu sequesters beta-transducin repeat-containing protein (betaTrCP) in the cytoplasm and provokes the accumulation of beta-catenin and other SCFbetaTrCP substrates.
14523047 2003 A hypermorphic IkappaBalpha mutation is associated with autosomal dominant anhidrotic ectodermal dysplasia and T cell immunodeficiency.
13680285 2004 A polymorphism of the NFKBIA gene is associated with Crohn's disease patients lacking a predisposing allele of the CARD15 gene.
12973300 2003 Directed expression of the HIV-1 accessory protein Vpu in Drosophila fat-body cells inhibits Toll-dependent immune responses.
12972430 2003 Cytoplasmic IkappaBalpha increases NF-kappaB-independent transcription through binding to histone deacetylase (HDAC) 1 and HDAC3.
12944982 2003 Inhibitor kappa B-alpha (IkappaB-alpha) promoter polymorphisms in UK and Dutch sarcoidosis.
12921778 2003 Okadaic acid induces sustained activation of NFkappaB and degradation of the nuclear IkappaBalpha in human neutrophils.
12897149 2003 HSP27 is a ubiquitin-binding protein involved in I-kappaBalpha proteasomal degradation.
12748192 2003 Phosphorylation of threonine 10 on CKBBP1/SAG/ROC2/Rbx2 by protein kinase CKII promotes the degradation of IkappaBalpha and p27Kip1.
12730857 2003 Rho kinase blockade prevents inflammation via nuclear factor kappa B inhibition: evidence in Crohn's disease and experimental colitis.
12711606 2003 Hydrogen peroxide activates NF-kappa B through tyrosine phosphorylation of I kappa B alpha and serine phosphorylation of p65: evidence for the involvement of I kappa B alpha kinase and Syk protein-tyrosine kinase.
12704657 2003 Induced stabilization of IkappaBalpha can facilitate its re-synthesis and prevent sequential degradation.
12651903 2003 The effects of labour and of interleukin 1 beta upon the expression of nuclear factor kappa B related proteins in human amnion.
12620896 2003 IkappaBalpha-dependent regulation of low-shear flow-induced NF-kappa B activity: role of nitric oxide.
12589049 2003 IkappaBalpha and p65 regulate the cytoplasmic shuttling of nuclear corepressors: cross-talk between Notch and NFkappaB pathways.
12518988 2002 Radiosensitization by overexpression of the nonphosphorylation form of IkappaB-alpha in human glioma cells.
12508121 2003 The DNA sequence and analysis of human chromosome 14.
12486103 2002 The PAAD/PYRIN-family protein ASC is a dual regulator of a conserved step in nuclear factor kappaB activation pathways.
12482991 2003 betaTrCP-mediated proteolysis of NF-kappaB1 p105 requires phosphorylation of p105 serines 927 and 932.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12433922 2003 NF-kappa B and I kappa B alpha are found in the mitochondria. Evidence for regulation of mitochondrial gene expression by NF-kappa B.
12429743 2003 Tyrosine phosphorylation of I kappa B alpha activates NF kappa B through a redox-regulated and c-Src-dependent mechanism following hypoxia/reoxygenation.
12419806 2003 Post-activation turn-off of NF-kappa B-dependent transcription is regulated by acetylation of p65.
12406554 2002 Polymorphic variants of NFKB1 and its inhibitory protein NFKBIA, and their involvement in sporadic breast cancer.
12388747 2002 Radiation-induced activation of nuclear factor-kappaB involves selective degradation of plasma membrane-associated I(kappa)B(alpha).
12377412 2002 Identification of polymorphisms of the IkappaBalpha gene associated with an increased risk of multiple myeloma.
12297126 2002 Demonstration of an activation regulated NF-kappaB/I-kappaBalpha complex in human platelets.
12244195 2002 NF-kappa B regulation in human neutrophils by nuclear I kappa B alpha: correlation to apoptosis.
12193729 2002 Inhibition of NF-kappa B activity by a membrane-transducing mutant of I kappa B alpha.
12167702 2002 Inactivation of NF-kappaB-dependent cell survival, a novel mechanism for the proapoptotic function of c-Abl.
12086926 2002 Lipid-induced insulin resistance in human muscle is associated with changes in diacylglycerol, protein kinase C, and IkappaB-alpha.
12084717 2002 Secretory leucoprotease inhibitor prevents lipopolysaccharide-induced IkappaBalpha degradation without affecting phosphorylation or ubiquitination.
11983170 2002 Visualization of interactions among bZIP and Rel family proteins in living cells using bimolecular fluorescence complementation.
11931770 2002 Peptide-induced negative selection of thymocytes activates transcription of an NF-kappa B inhibitor.
11913973 2002 A novel in vitro assay for deubiquitination of I kappa B alpha.
11809792 2002 Receptor activator of NF-kappaB ligand (RANKL) activates TAK1 mitogen-activated protein kinase kinase kinase through a signaling complex containing RANK, TAB2, and TRAF6.
11799106 2002 The non-ankyrin C terminus of Ikappa Balpha physically interacts with p53 in vivo and dissociates in response to apoptotic stress, hypoxia, DNA damage, and transforming growth factor-beta 1-mediated growth suppression.
11696595 2001 The human immunodeficiency virus type 1 accessory protein Vpu induces apoptosis by suppressing the nuclear factor kappaB-dependent expression of antiapoptotic factors.
11511100 2001 Hiv-1 Tat can substantially enhance the capacity of NIK to induce IkappaB degradation.
11493922 2001 Erythropoietin-mediated neuroprotection involves cross-talk between Jak2 and NF-kappaB signalling cascades.
11313474 2001 Interaction between hnRNPA1 and IkappaBalpha is required for maximal activation of NF-kappaB-dependent transcription.
11287411 2001 Ikappa b-alpha, the NF-kappa B inhibitory subunit, interacts with ANT, the mitochondrial ATP/ADP translocator.
11278695 2001 The human immunodeficiency virus type 1 Vpu protein inhibits NF-kappa B activation by interfering with beta TrCP-mediated degradation of Ikappa B.
11124955 2001 SUMO-1 conjugation in vivo requires both a consensus modification motif and nuclear targeting.
11106428 2000 Identification of IkappaBalpha as a substrate of Fas-associated phosphatase-1.
11095741 2000 IFNalpha/beta promotes cell survival by activating NF-kappa B.
11042193 2001 Phospholipase C-gamma 2 couples Bruton's tyrosine kinase to the NF-kappaB signaling pathway in B lymphocytes.
10969074 2000 IkappaBalpha and IkappaBalpha /NF-kappa B complexes are retained in the cytoplasm through interaction with a novel partner, RasGAP SH3-binding protein 2.
10928981 2000 Yersinia enterocolitica invasin protein triggers IL-8 production in epithelial cells via activation of Rel p65-p65 homodimers.
10882136 2000 IKKepsilon is part of a novel PMA-inducible IkappaB kinase complex.
10869418 2000 Expression of CX3CR1 chemokine receptors on neurons and their role in neuronal survival.
10848576 2000 Mapping of atypical protein kinase C within the nerve growth factor signaling cascade: relationship to differentiation and survival of PC12 cells.
10783893 2000 NAK is an IkappaB kinase-activating kinase.
10747850 2000 L-929 cells harboring ectopically expressed RelA resist curcumin-induced apoptosis.
10733566 2000 Functional isoforms of IkappaB kinase alpha (IKKalpha) lacking leucine zipper and helix-loop-helix domains reveal that IKKalpha and IKKbeta have different activation requirements.
10723127 2000 Activation of NF-kappa B by the dsRNA-dependent protein kinase, PKR involves the I kappa B kinase complex.
10657303 2000 A subclass of Ras proteins that regulate the degradation of IkappaB.
10655476 2000 A nuclear export signal in the N-terminal regulatory domain of IkappaBalpha controls cytoplasmic localization of inactive NF-kappaB/IkappaBalpha complexes.
10644755 2000 Homodimer of two F-box proteins betaTrCP1 or betaTrCP2 binds to IkappaBalpha for signal-dependent ubiquitination.
10637284 2000 Clonal deleterious mutations in the IkappaBalpha gene in the malignant cells in Hodgkin's lymphoma.
10635328 1999 TRANCE, a TNF family member, activates Akt/PKB through a signaling complex involving TRAF6 and c-Src.
10582246 1999 Control of NF-kappa B transcriptional activation by signal induced proteolysis of I kappa B alpha.
10580107 1999 Human immunodeficiency virus-1-tat induces matrix metalloproteinase-9 in monocytes through protein tyrosine phosphatase-mediated activation of nuclear transcription factor NF-kappaB.
10521480 1999 The PEST domain of IkappaBalpha is necessary and sufficient for in vitro degradation by mu-calpain.
10498867 1999 NF-kappaB subunit p65 binds to 53BP2 and inhibits cell death induced by 53BP2.
10480634 1999 Extracellular HIV type 1 Tat protein induces CD69 expression through NF-kappaB activation: possible correlation with cell surface Tat-binding proteins.
10454581 1999 Direct association and nuclear import of the hepatitis B virus X protein with the NF-kappaB inhibitor IkappaBalpha.
10437795 1999 A complex containing betaTrCP recruits Cdc34 to catalyse ubiquitination of IkappaBalpha.
10421793 1999 IKK-i, a novel lipopolysaccharide-inducible kinase that is related to IkappaB kinases.
10398585 1999 Serine 32 and serine 36 of IkappaBalpha are directly phosphorylated by protein kinase CKII in vitro.
10393859 1999 Nitric oxide inhibits HIV tat-induced NF-kappaB activation.
10329681 1999 Identification of the ubiquitin carrier proteins, E2s, involved in signal-induced conjugation and subsequent degradation of IkappaBalpha.
10102628 1999 Expression of IkappaBalpha in the nucleus of human peripheral blood T lymphocytes.
10085062 1999 Mitogen-activated protein kinase/ERK kinase kinases 2 and 3 activate nuclear factor-kappaB through IkappaB kinase-alpha and IkappaB kinase-beta.
10026139 1999 IkappaB-alpha enhances transactivation by the HOXB7 homeodomain-containing protein.
9990853 1999 Signal-induced ubiquitination of IkappaBalpha by the F-box protein Slimb/beta-TrCP.
9892650 1999 Involvement of regulatory and catalytic subunits of phosphoinositide 3-kinase in NF-kappaB activation.
9882613 1999 Association of protein-tyrosine phosphatase PTP-BAS with the transcription-factor-inhibitory protein IkappaBalpha through interaction between the PDZ1 domain and ankyrin repeats.
9873017 1999 Tumor necrosis factor-alpha-inducible IkappaBalpha proteolysis mediated by cytosolic m-calpain. A mechanism parallel to the ubiquitin-proteasome pathway for nuclear factor-kappab activation.
9865694 1998 The crystal structure of the IkappaBalpha/NF-kappaB complex reveals mechanisms of NF-kappaB inactivation.
9865693 1998 Structure of an IkappaBalpha/NF-kappaB complex.
9859996 1998 Identification of the receptor component of the IkappaBalpha-ubiquitin ligase.
9792645 1998 Tumor necrosis factor-alpha activation of nuclear transcription factor-kappaB in marrow macrophages is mediated by c-Src tyrosine phosphorylation of Ikappa Balpha.
9738011 1998 Ikappa Balpha functions through direct contacts with the nuclear localization signals and the DNA binding sequences of NF-kappaB.
9734360 1998 SUMO-1 modification of IkappaBalpha inhibits NF-kappaB activation.
9721103 1998 Direct phosphorylation of IkappaB by IKKalpha and IKKbeta: discrimination between free and NF-kappaB-bound substrate.
9566883 1998 The N-terminal domain of IkappaB alpha masks the nuclear localization signal(s) of p50 and c-Rel homodimers.
9566872 1998 Nuclear localization of IkappaB alpha is mediated by the second ankyrin repeat: the IkappaB alpha ankyrin repeats define a novel class of cis-acting nuclear import sequences.
9520446 1998 NF-kappaB-inducing kinase activates IKK-alpha by phosphorylation of Ser-176.
9452483 1998 Involvement of valosin-containing protein, an ATPase Co-purified with IkappaBalpha and 26 S proteasome, in ubiquitin-proteasome-mediated degradation of IkappaBalpha.
9409737 1997 Ubch9 conjugates SUMO but not ubiquitin.
9372968 1997 I kappaB alpha physically interacts with a cytoskeleton-associated protein through its signal response domain.
9334723 1997 HIV-1 Vpr suppresses immune activation and apoptosis through regulation of nuclear factor kappa B.
9252186 1997 A cytokine-responsive IkappaB kinase that activates the transcription factor NF-kappaB.
9244310 1997 Identification and characterization of an IkappaB kinase.
9214631 1997 IkappaB alpha is a target for the mitogen-activated 90 kDa ribosomal S6 kinase.
9060679 1997 Distinct domains of IkappaB-alpha inhibit human immunodeficiency virus type 1 replication through NF-kappaB and Rev.
8940099 1996 Site-specific tyrosine phosphorylation of IkappaBalpha negatively regulates its inducible phosphorylation and degradation.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
8797825 1996 Tyrosine phosphorylation of I kappa B-alpha activates NF-kappa B without proteolytic degradation of I kappa B-alpha.
8709193 1996 Transdominant mutants of I kappa B alpha block Tat-tumor necrosis factor synergistic activation of human immunodeficiency virus type 1 gene expression and virus multiplication.
8657113 1996 Phosphorylation of IkappaBalpha in the C-terminal PEST domain by casein kinase II affects intrinsic protein stability.
8657102 1996 Mapping of the inducible IkappaB phosphorylation sites that signal its ubiquitination and degradation.
8622692 1996 Casein kinase II phosphorylates I kappa B alpha at S-283, S-289, S-293, and T-291 and is required for its degradation.
8615004 1996 Differential effects of I kappa B molecules on Tat-mediated transactivation of HIV-1 LTR.
8601309 1996 Site-specific phosphorylation of IkappaBalpha by a novel ubiquitination-dependent protein kinase activity.
7878004 1995 Regulation of human retroviral latency by the NF-kappa B/I kappa B family: inhibition of human immunodeficiency virus replication by I kappa B through a Rev-dependent mechanism.
7739562 1995 Coupling of a signal response domain in I kappa B alpha to multiple pathways for NF-kappa B activation.
7700645 1995 Tax protein of HTLV-1 destabilizes the complexes of NF-kappa B and I kappa B-alpha and induces nuclear translocation of NF-kappa B for transcriptional activation.
7679069 1993 Nuclear uptake control of NF-kappa B by MAD-3, an I kappa B protein present in the nucleus.
7565415 1995 Regulation of human immunodeficiency virus type 1 and cytokine gene expression in myeloid cells by NF-kappa B/Rel transcription factors.
7479976 1995 Signal-induced degradation of I kappa B alpha requires site-specific ubiquitination.
3140380 1988 I kappa B: a specific inhibitor of the NF-kappa B transcription factor.
1829648 1991 Characterization of an immediate-early gene induced in adherent monocytes that encodes I kappa B-like activity.
1493333 1992 I kappa B/MAD-3 masks the nuclear localization signal of NF-kappa B p65 and requires the transactivation domain to inhibit NF-kappa B p65 DNA binding.
1427874 1992 Chromosomal localization of the genes encoding the p50/p105 subunits of NF-kappa B (NFKB2) and the I kappa B/MAD-3 (NFKBI) inhibitor of NF-kappa B to 4q24 and 14q13, respectively.