Property Summary

Ligand Count 1
NCBI Gene PubMed Count 231
PubMed Score 191.31
PubTator Score 966.22

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Disease Target Count
Abnormal size of pituitary gland 1
Abnormality of cells of the lymphoid lineage 2
Abnormality of the periungual region 1
Absence of B cells 4
Absent B cells 4
Adrenocorticotropin deficient adrenal insufficiency 4
Anemia, Hemolytic 55
Anus, Imperforate 46
Asthma 385
Autoimmune thrombocytopenia 22
Brachycephaly 88
Broad cranium shape 88
Bronchiectasis 64
Chronic otitis media 52
Decreased antibody level in blood 35
Decreased circulating ACTH level 12
Dystrophia unguium 53
Elevated hepatic transaminases 81
Fatigue 182
Hepatic enzyme increased 81
Highly variable severity 157
Hypogammaglobulinemia 35
Hypoglycemic coma 10
Hyponatremia 25
Hypotension 82
Idiopathic thrombocytopenia 22
Immune thrombocytopenic purpura 24
Immunologic Deficiency Syndromes 113
Infectious disease of lung 29
Liver Dysfunction 99
Liver enzymes abnormal 81
Liver function test increased 81
Liver function tests abnormal finding 81
Low to undetectable plasma cortisol 12
Lymphadenopathy 62
Lymphopenia 67
Multiple pulmonary infections 29
Pneumonia 174
Purpura 43
Reactive airway disease 21
Recurrent bronchitis 23
Recurrent hypoglycemia 4
Recurrent otitis media 42
Recurrent pneumonia 29
Recurrent pulmonary infections 29
Recurrent respiratory infections 141
Recurrent sinus disease 22
Recurrent sinusitis 22
Secondary Adrenal Insufficiency 6
Splenomegaly 190
Subclinical abnormal liver function tests 81
Transaminases increased 81
Variable expressivity 157
Wide skull shape 88
ear infection chronic 52
pharyngitis recurrent 4
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7
Disease Target Count Z-score Confidence
Cancer 2499 3.984 2.0

Expression

  Differential Expression (6)

Disease log2 FC p
Atopic dermatitis 1.100 7.9e-05
lung cancer -1.400 3.0e-03
osteosarcoma -1.829 1.6e-06
pancreatic ductal adenocarcinoma liver m... 1.029 2.3e-02
Rheumatoid arthritis -1.100 3.4e-02
tuberculosis -1.300 2.0e-07

Protein-protein Interaction (2)

Gene RIF (179)

AA Sequence

MESCYNPGLDGIIEYDDFKLNSSIVEPKEPAPETADGPYLVIVEQPKQRGFRFRYGCEGPSHGGLPGASS      1 - 70
EKGRKTYPTVKICNYEGPAKIEVDLVTHSDPPRAHAHSLVGKQCSELGICAVSVGPKDMTAQFNNLGVLH     71 - 140
VTKKNMMGTMIQKLQRQRLRSRPQGLTEAEQRELEQEAKELKKVMDLSIVRLRFSAFLRASDGSFSLPLK    141 - 210
PVISQPIHDSKSPGASNLKISRMDKTAGSVRGGDEVYLLCDKVQKDDIEVRFYEDDENGWQAFGDFSPTD    211 - 280
VHKQYAIVFRTPPYHKMKIERPVTVFLQLKRKRGGDVSDSKQFTYYPLVEDKEEVQRKRRKALPTFSQPF    281 - 350
GGGSHMGGGSGGAAGGYGGAGGGGSLGFFPSSLAYSPYQSGAGPMGCYPGGGGGAQMAATVPSRDSGEEA    351 - 420
AEPSAPSRTPQCEPQAPEMLQRAREYNARLFGLAQRSARALLDYGVTADARALLAGQRHLLTAQDENGDT    421 - 490
PLHLAIIHGQTSVIEQIVYVIHHAQDLGVVNLTNHLHQTPLHLAVITGQTSVVSFLLRVGADPALLDRHG    491 - 560
DSAMHLALRAGAGAPELLRALLQSGAPAVPQLLHMPDFEGLYPVHLAVRARSPECLDLLVDSGAEVEATE    561 - 630
RQGGRTALHLATEMEELGLVTHLVTKLRANVNARTFAGNTPLHLAAGLGYPTLTRLLLKAGADIHAENEE    631 - 700
PLCPLPSPPTSDSDSDSEGPEKDTRSSFRGHTPLDLTCSTKVKTLLLNAAQNTMEPPLTPPSPAGPGLSL    701 - 770
GDTALQNLEQLLDGPEAQGSWAELAERLGLRSLVDTYRQTTSPSGSLLRSYELAGGDLAGLLEALSDMGL    771 - 840
EEGVRLLRGPETRDKLPSTAEVKEDSAYGSQSVEQEAEKLGPPPEPPGGLCHGHPQPQVH              841 - 900
//

Text Mined References (237)

PMID Year Title