Property Summary

NCBI Gene PubMed Count 34
PubMed Score 77.17
PubTator Score 39.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (25)

Disease log2 FC p
Rheumatoid Arthritis 1.200 3.9e-02
hepatocellular carcinoma -1.200 4.0e-05
Multiple myeloma 1.696 2.5e-02
chronic lymphosyte leukemia -1.100 2.5e-09
glioblastoma 2.400 5.4e-03
atypical teratoid/rhabdoid tumor -1.400 1.1e-03
juvenile dermatomyositis 1.318 6.1e-06
acute quadriplegic myopathy 1.442 7.7e-04
adrenocortical carcinoma -2.340 1.6e-06
tuberculosis and treatment for 6 months 1.200 1.2e-03
pancreatic ductal adenocarcinoma liver m... -2.560 5.8e-03
intraductal papillary-mucinous adenoma (... -2.200 7.9e-04
intraductal papillary-mucinous carcinoma... -1.700 7.3e-03
lung cancer -3.300 1.1e-06
diabetes mellitus -2.000 2.6e-02
posterior fossa group A ependymoma 1.100 2.2e-03
invasive ductal carcinoma -1.197 1.1e-02
psoriasis -1.900 7.9e-08
lung carcinoma -1.800 1.9e-11
Breast cancer -1.300 9.6e-04
acute myeloid leukemia 1.200 7.9e-03
ovarian cancer 2.100 3.8e-04
pituitary cancer -2.100 5.3e-03
chronic rhinosinusitis -1.333 2.2e-02
pancreatic cancer 1.600 2.1e-02

Protein-protein Interaction (4)

Gene RIF (17)

PMID Text
26102033 E4BP4 and BIM regulation correlated with that of RCAN1-1. A putative GRE and four EBPREs were identified within 1500bp upstream from the transcription start site of RCAN1-1
25338303 Results conclude that the transcriptional repressor E4BP4 plays a role in repressing epigenetically regulated SOSTDC1 expression in breast cancer cells, which can be reverted by E4BP4 silencing.
24280221 NFIL3 plays a neuroprotective role in neurons and constitutes a potential therapeutic target for neurodegeneration.
23630076 NFIL3 alters cancer cell behavior and FOXO function by acting on chromatin to restrict the menu of FOXO target genes
23340290 Data indicate that E4BP4 can inhibit CD40L expression through epigenetic modifications in the promoter region of CD40L.
23283977 G9a mediates E4BP4-dependent suppression of hepatic Fgf21 by enhancing histone methylation (H3K9me2) of the Fgf21 promoter
22947103 The clock-regulated and immune system modulator transcription factor E4BP4/ NFIL3 likely regulates the expression of both appb in zebrafish and APP in humans.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20186462 Conclude that E4BP4 plays as a survival factor in heart and E4BP4 is essential for proper embryonic heart development.
20174623 Observational study of gene-disease association. (HuGE Navigator)
19839995 Observational study of gene-disease association. (HuGE Navigator)
19693801 Observational study of gene-disease association. (HuGE Navigator)
19129193 Identification of adjacent binding sites for the YY1 and E4BP4 transcription factors in the PrP (Prion) gene promoter.
19058789 Observational study of gene-disease association. (HuGE Navigator)
18937294 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
18829486 E4BP4 has a role as osteoblast transcriptional repressor in inhibiting both Runx2 and Osterix in myeloma bone disease
16630563 This report demonstrates that GC-mediated upregulation of the bZIP transcriptional repressor gene, E4BP4, is dependent on [Ca2+]i levels, and correlates with GC-evoked apoptosis of GC-sensitive CEM-C7-14 cells.

AA Sequence

MQLRKMQTVKKEQASLDASSNVDKMMVLNSALTEVSEDSTTGEELLLSEGSVGKNKSSACRRKREFIPDE      1 - 70
KKDAMYWEKRRKNNEAAKRSREKRRLNDLVLENKLIALGEENATLKAELLSLKLKFGLISSTAYAQEIQK     71 - 140
LSNSTAVYFQDYQTSKSNVSSFVDEHEPSMVSSSCISVIKHSPQSSLSDVSEVSSVEHTQESSVQGSCRS    141 - 210
PENKFQIIKQEPMELESYTREPRDDRGSYTASIYQNYMGNSFSGYSHSPPLLQVNRSSSNSPRTSETDDG    211 - 280
VVGKSSDGEDEQQVPKGPIHSPVELKHVHATVVKVPEVNSSALPHKLRIKAKAMQIKVEAFDNEFEATQK    281 - 350
LSSPIDMTSKRHFELEKHSAPSMVHSSLTPFSVQVTNIQDWSLKSEHWHQKELSGKTQNSFKTGVVEMKD    351 - 420
SGYKVSDPENLYLKQGIANLSAEVVSLKRLIATQPISASDSG                                421 - 462
//

Text Mined References (46)

PMID Year Title
26102033 2015 Glucocorticoid-mediated co-regulation of RCAN1-1, E4BP4 and BIM in human leukemia cells susceptible to apoptosis.
25772364 2015 SUMO-2 Orchestrates Chromatin Modifiers in Response to DNA Damage.
25755297 2015 System-wide Analysis of SUMOylation Dynamics in Response to Replication Stress Reveals Novel Small Ubiquitin-like Modified Target Proteins and Acceptor Lysines Relevant for Genome Stability.
25609649 2015 Proteomic analyses reveal distinct chromatin-associated and soluble transcription factor complexes.
25416956 2014 A proteome-scale map of the human interactome network.
25338303 2014 E4BP4 is a repressor of epigenetically regulated SOSTDC1 expression in breast cancer cells.
25218447 2014 Uncovering global SUMOylation signaling networks in a site-specific manner.
25114211 2014 Mapping of SUMO sites and analysis of SUMOylation changes induced by external stimuli.
24280221 2014 Neuroprotective role of the basic leucine zipper transcription factor NFIL3 in models of amyotrophic lateral sclerosis.
23630076 2013 Survival factor NFIL3 restricts FOXO-induced gene expression in cancer.
23340290 2013 E4BP4 overexpression: a protective mechanism in CD4+ T cells from SLE patients.
23283977 2013 Recruitment of histone methyltransferase G9a mediates transcriptional repression of Fgf21 gene by E4BP4 protein.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23128233 2012 Host-microbe interactions have shaped the genetic architecture of inflammatory bowel disease.
22947103 2012 Using BAC transgenesis in zebrafish to identify regulatory sequences of the amyloid precursor protein gene in humans.
21516116 2011 Next-generation sequencing to generate interactome datasets.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20186462 2010 E4BP4 is a cardiac survival factor and essential for embryonic heart development.
20174623 2010 Systematic analysis of circadian genes in a population-based sample reveals association of TIMELESS with depression and sleep disturbance.
20102225 2010 Identification of bZIP interaction partners of viral proteins HBZ, MEQ, BZLF1, and K-bZIP using coiled-coil arrays.
20093779 2010 A promoter in the novel exon of hPPARgamma directs the circadian expression of PPARgamma.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19839995 2009 Association study of 21 circadian genes with bipolar I disorder, schizoaffective disorder, and schizophrenia.
19693801 2010 PER2 variantion is associated with depression vulnerability.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19129193 2009 Identification of adjacent binding sites for the YY1 and E4BP4 transcription factors in the ovine PrP (Prion) gene promoter.
19058789 2009 A common variant in DRD3 receptor is associated with autism spectrum disorder.
18937294 2008 Genome-wide association scan of the time to onset of attention deficit hyperactivity disorder.
18829486 2008 Negative regulation of the osteoblast function in multiple myeloma through the repressor gene E4BP4 activated by malignant plasma cells.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16630563 2006 Calcium-dependent upregulation of E4BP4 expression correlates with glucocorticoid-evoked apoptosis of human leukemic CEM cells.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15164053 2004 DNA sequence and analysis of human chromosome 9.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12805554 2003 Comprehensive identification of human bZIP interactions with coiled-coil arrays.
12743120 2003 Parathyroid hormone-induced E4BP4/NFIL3 down-regulates transcription in osteoblasts.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10942106 2000 Exclusion of NFIL3 as the gene causing hereditary sensory neuropathy type I by mutation analysis.
9122243 1997 Pivotal role for the NFIL3/E4BP4 transcription factor in interleukin 3-mediated survival of pro-B lymphocytes.
8836190 1996 Protein-protein interaction between the transcriptional repressor E4BP4 and the TBP-binding protein Dr1.
8076819 1994 The addition of 5'-coding information to a 3'-directed cDNA library improves analysis of gene expression.
7565758 1995 Molecular cloning and characterization of NF-IL3A, a transcriptional activator of the human interleukin-3 promoter.
1620116 1992 Transcriptional repression by a novel member of the bZIP family of transcription factors.