Property Summary

NCBI Gene PubMed Count 41
PubMed Score 41.88
PubTator Score 38.76

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (20)

Disease log2 FC p
Rheumatoid Arthritis 1.300 5.4e-04
astrocytic glioma 1.900 2.8e-02
posterior fossa group A ependymoma 1.800 3.1e-05
osteosarcoma -1.698 3.5e-02
sonic hedgehog group medulloblastoma 2.100 5.1e-05
atypical teratoid/rhabdoid tumor 1.400 9.0e-04
adrenocortical carcinoma -1.064 1.2e-04
pancreatic ductal adenocarcinoma liver m... -1.897 4.1e-03
tuberculosis 1.100 1.4e-04
non-small cell lung cancer -1.811 1.3e-17
breast carcinoma -1.400 2.9e-05
lung adenocarcinoma -1.300 3.4e-06
acute myeloid leukemia -1.900 2.3e-02
subependymal giant cell astrocytoma -2.121 1.5e-02
invasive ductal carcinoma -1.800 3.7e-03
Breast cancer -1.800 1.4e-03
spina bifida -1.407 4.1e-02
Pick disease 1.300 5.0e-05
ductal carcinoma in situ -1.200 2.4e-04
ovarian cancer -2.600 3.1e-07

Gene RIF (23)

PMID Text
26329426 microRNA-136 targeted and degraded NFIA, which induced the release of microRNA-223, promoting CD11b expression. Direct base pairing occurs between miR-136 and the 3' UTR of NFIA mRNA.
25714559 this family also carried a microdeletion affecting solely the NFIA gene, this study substantiates the importance of this gene in craniofacial development.
25544502 NFI-A is involved in the miR-21-induced expression of IL-10 in B cells in nasopharyngeal carcinoma; Il-10 is capable of suppressing CD8+ T-cell activities.
25265644 RP5-833A20.1/miR-382-5p/NFIA pathway was essential to the regulation of cholesterol homeostasis and inflammatory reactions.
25220407 TGF-beta-mediated suppression of ANT2 through NF1/Smad4 complexes contributes to oxidative stress and DNA damage during induction of cellular senescence.
24560411 a strong candidate gene for asthma and allergic rhinitis
24462883 This report presents the first case of an intragenic deletion within the NFIA gene that is still consistent with classic clinical phenotypes present in previously reported cases of chromosome 1p31.3 related deletion.
24305710 High nuclear factor IA expression is associated with glioblastomas.
23946414 These studies represent the first characterization of miR-223/NFIA axis function in glioma
22925353 These data suggest that genetic variants in the NF1A gene region may predispose to seasonal patterned of mania in bipolar disorder.
22807310 NFIA expression in white matter lesions of human newborns with neonatal HIE, as well active MS lesions in adults, revealed that it is similarly expressed in oligodendrocyte progenitors and not oligodendrocytes.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19542302 in early hematopoiesis, the NFI-A expression level acts as a novel factor channeling HPCs into either the E or G lineage
19540848 NFI family of transcription factors plays a key role in the regulation of both the B-FABP and GFAP genes in malignant glioma cells.
17530927 The mouse Nfia mutant phenotype and the common features among five human cases indicate that NFIA haploinsufficiency contributes to a novel human central nervous system malformation syndrome that can also include ureteral and renal defects.
17010934 The NF1-A transcription factor plays an important role in the transcriptional activation of the TR2 orphan receptor gene expression via a promoter activating cis-element.
16325577 Data show that human granulocytic differentiation is controlled by a regulatory circuitry involving miR-223 and two transcriptional factors, NFI-A and C/EBPalpha.
15598822 Distribution of nuclear factor I binding sites correlate with Z-DNA forming regions in human chromosome 22.
15466411 nuclear factor I has a role in the intrinsic control of cerebellar granule neuron gene expression
15458926 Role in the expression mechanism of hNaPi-IIb gene transcription.
10518556 Disruption of the Nfia gene in the mouse causes perinatal lethality, agenesis of the corpus callosum and hydrocephalus.

AA Sequence

MYSPLCLTQDEFHPFIEALLPHVRAFAYTWFNLQARKRKYFKKHEKRMSKEEERAVKDELLSEKPEVKQK      1 - 70
WASRLLAKLRKDIRPEYREDFVLTVTGKKPPCCVLSNPDQKGKMRRIDCLRQADKVWRLDLVMVILFKGI     71 - 140
PLESTDGERLVKSPQCSNPGLCVQPHHIGVSVKELDLYLAYFVHAADSSQSESPSQPSDADIKDQPENGH    141 - 210
LGFQDSFVTSGVFSVTELVRVSQTPIAAGTGPNFSLSDLESSSYYSMSPGAMRRSLPSTSSTSSTKRLKS    211 - 280
VEDEMDSPGEEPFYTGQGRSPGSGSQSSGWHEVEPGMPSPTTLKKSEKSGFSSPSPSQTSSLGTAFTQHH    281 - 350
RPVITGPRASPHATPSTLHFPTSPIIQQPGPYFSHPAIRYHPQETLKEFVQLVCPDAGQQAGQVGFLNPN    351 - 420
GSSQGKVHNPFLPTPMLPPPPPPPMARPVPLPVPDTKPPTTSTEGGAASPTSPTYSTPSTSPANRFVSVG    421 - 490
PRDPSFVNIPQQTQSWYLG                                                       491 - 509
//

Text Mined References (48)

PMID Year Title
26329426 2016 TNF-?-mediated microRNA-136 induces differentiation of myeloid cells by targeting NFIA.
25714559 2015 Familial craniosynostosis associated with a microdeletion involving the NFIA gene.
25544502 2015 Nasopharyngeal cancer-derived microRNA-21 promotes immune suppressive B cells.
25265644 2015 RP5-833A20.1/miR-382-5p/NFIA-dependent signal transduction pathway contributes to the regulation of cholesterol homeostasis and inflammatory reaction.
25220407 2014 TGF-?/NF1/Smad4-mediated suppression of ANT2 contributes to oxidative stress in cellular senescence.
24560411 2014 The nuclear factor I/A (NFIA) gene is associated with the asthma plus rhinitis phenotype.
24462883 2014 An intragenic deletion of the NFIA gene in a patient with a hypoplastic corpus callosum, craniofacial abnormalities and urinary tract defects.
24305710 2014 A novel tumor-promoting role for nuclear factor IA in glioblastomas is mediated through negative regulation of p53, p21, and PAI1.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23946414 2013 The miR-223/nuclear factor I-A axis regulates glial precursor proliferation and tumorigenesis in the CNS.
23463857 2013 Genome- and phenome-wide analyses of cardiac conduction identifies markers of arrhythmia risk.
23408906 2013 A meta-analysis of thyroid-related traits reveals novel loci and gender-specific differences in the regulation of thyroid function.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22925353 2013 A genome-wide association study of seasonal pattern mania identifies NF1A as a possible susceptibility gene for bipolar disorder.
22807310 2012 Evidence that nuclear factor IA inhibits repair after white matter injury.
21829377 2011 Genetic loci associated with plasma phospholipid n-3 fatty acids: a meta-analysis of genome-wide association studies from the CHARGE Consortium.
21738484 2011 Genome-wide association of bipolar disorder suggests an enrichment of replicable associations in regions near genes.
21076409 2010 Common variants in 22 loci are associated with QRS duration and cardiac ventricular conduction.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20190752 2010 Multiple common variants for celiac disease influencing immune gene expression.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19542302 2009 NFI-A directs the fate of hematopoietic progenitors to the erythroid or granulocytic lineage and controls beta-globin and G-CSF receptor expression.
19540848 2009 Nuclear factor I regulates brain fatty acid-binding protein and glial fibrillary acidic protein gene expression in malignant glioma cell lines.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18220336 2008 Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17530927 2007 NFIA haploinsufficiency is associated with a CNS malformation syndrome and urinary tract defects.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
17010934 2006 Transcriptional regulation of the human TR2 orphan receptor gene by nuclear factor 1-A.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16325577 2005 A minicircuitry comprised of microRNA-223 and transcription factors NFI-A and C/EBPalpha regulates human granulopoiesis.
15684392 2005 FOXC1 transcriptional regulatory activity is impaired by PBX1 in a filamin A-mediated manner.
15598822 2004 Distributions of Z-DNA and nuclear factor I in human chromosome 22: a model for coupled transcriptional regulation.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15466411 2004 A role for nuclear factor I in the intrinsic control of cerebellar granule neuron gene expression.
15458926 2005 NF1 transcriptional factor(s) is required for basal promoter activation of the human intestinal NaPi-IIb cotransporter gene.
15302935 2004 Large-scale characterization of HeLa cell nuclear phosphoproteins.
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12107410 2002 Expressed sequence tag analysis of human RPE/choroid for the NEIBank Project: over 6000 non-redundant transcripts, novel genes and splice variants.
10718198 2000 Prediction of the coding sequences of unidentified human genes. XVI. The complete sequences of 150 new cDNA clones from brain which code for large proteins in vitro.
10518556 1999 Disruption of the murine nuclear factor I-A gene (Nfia) results in perinatal lethality, hydrocephalus, and agenesis of the corpus callosum.
10085123 1999 CREB binding protein coordinates the function of multiple transcription factors including nuclear factor I to regulate phosphoenolpyruvate carboxykinase (GTP) gene transcription.
7590749 1995 Chromosomal localization of the four genes (NFIA, B, C, and X) for the human transcription factor nuclear factor I by FISH.