Property Summary

NCBI Gene PubMed Count 33
PubMed Score 36.76
PubTator Score 20.87

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
psoriasis -1.800 3.8e-05
osteosarcoma -1.255 2.8e-03
primary pancreatic ductal adenocarcinoma 1.114 3.4e-03
intraductal papillary-mucinous carcinoma... 1.200 2.7e-03
breast carcinoma 1.600 3.5e-02
subependymal giant cell astrocytoma 1.337 7.9e-03
ovarian cancer -1.800 7.1e-09

Gene RIF (12)

PMID Text
26231763 Nrf1 is negatively regulated by its O-GlcNAcylation status that depends on the glucose concentrations
24448410 Data uncover an unexpected role for p97 in activation of transcription factor Nrf1 by relocalizing it from the endoplasmic reticulum lumen to the cytosol.
23816881 The study identifies casein kinase 2 as an NRF1-binding protein and finds that the knockdown of casein kinase 2 enhances the NRF1-dependent expression of the proteasome subunit genes.
23623971 GSK3 regulates Nrf1 expression and cell survival function in response to stress activation.
22971132 findings suggest that nuclear-related factor erythroid 2 transcription factor (Nrf1) may play a role in maintaining genomic integrity, and that Nrf1 dysregulation may induce tumorigenesis
22932898 A proteasome inhibitor-stimulated Nrf1 protein-dependent compensatory increase in proteasome subunit gene expression reduces polycomb group protein level
22216197 data suggests that Nrf1 is controlled by several post-translational mechanisms, including ubiquitination, proteolytic processing and proteasomal-mediated degradation as well as by its phosphorylation status
20932482 Report that proteasome inhibition can be anticipated by TCF11-dependent activation of human proteasome gene expression, which in turn is controlled by a HRD1-p97-ERAD feedback circle.
20385086 Data show that nuclear factor erythroid-derived 2-related factor 1 (Nrf1), but not the related Nrf2, is necessary for induced proteasome gene transcription in mouse embryonic fibroblasts.
20237496 Observational study of gene-disease association. (HuGE Navigator)
17609210 p65Nrf1 has the potential to play an important role in modulating the response to oxidative stress by functioning as a transdominant repressor of Nrf2-mediated activation of ARE-dependent gene transcription
12729924 A nuclear export signal (NES) localised in the N-terminus of TCF11 is responsible for the active nuclear export of the protein.

AA Sequence

MLSLKKYLTEGLLQFTILLSLIGVRVDVDTYLTSQLPPLREIILGPSSAYTQTQFHNLRNTLDGYGIHPK      1 - 70
SIDLDNYFTARRLLSQVRALDRFQVPTTEVNAWLVHRDPEGSVSGSQPNSGLALESSSGLQDVTGPDNGV     71 - 140
RESETEQGFGEDLEDLGAVAPPVSGDLTKEDIDLIDILWRQDIDLGAGREVFDYSHRQKEQDVEKELRDG    141 - 210
GEQDTWAGEGAEALARNLLVDGETGESFPAQVPSGEDQTALSLEECLRLLEATCPFGENAEFPADISSIT    211 - 280
EAVPSESEPPALQNNLLSPLLTGTESPFDLEQQWQDLMSIMEMQAMEVNTSASEILYSAPPGDPLSTNYS    281 - 350
LAPNTPINQNVSLHQASLGGCSQDFLLFSPEVESLPVASSSTLLPLAPSNSTSLNSTFGSTNLTGLFFPP    351 - 420
QLNGTANDTAGPELPDPLGGLLDEAMLDEISLMDLAIEEGFNPVQASQLEEEFDSDSGLSLDSSHSPSSL    421 - 490
SSSEGSSSSSSSSSSSSSSASSSASSSFSEEGAVGYSSDSETLDLEEAEGAVGYQPEYSKFCRMSYQDPA    491 - 560
QLSCLPYLEHVGHNHTYNMAPSALDSADLPPPSALKKGSKEKQADFLDKQMSRDEHRARAMKIPFTNDKI    561 - 630
INLPVEEFNELLSKYQLSEAQLSLIRDIRRRGKNKMAAQNCRKRKLDTILNLERDVEDLQRDKARLLREK    631 - 700
VEFLRSLRQMKQKVQSLYQEVFGRLRDENGRPYSPSQYALQYAGDGSVLLIPRTMADQQARRQERKPKDR    701 - 770
RK                                                                        771 - 772
//

Text Mined References (34)

PMID Year Title
26231763 2015 Transcription factor Nrf1 is negatively regulated by its O-GlcNAcylation status.
24448410 2014 p97-dependent retrotranslocation and proteolytic processing govern formation of active Nrf1 upon proteasome inhibition.
23816881 2013 The casein kinase 2-nrf1 axis controls the clearance of ubiquitinated proteins by regulating proteasome gene expression.
23623971 2013 Glycogen synthase kinase 3 regulates expression of nuclear factor-erythroid-2 related transcription factor-1 (Nrf1) and inhibits pro-survival function of Nrf1.
22971132 2012 Deficiency in the nuclear-related factor erythroid 2 transcription factor (Nrf1) leads to genetic instability.
22949513 2012 Genome-wide association analysis of genetic generalized epilepsies implicates susceptibility loci at 1q43, 2p16.1, 2q22.3 and 17q21.32.
22932898 2012 A proteasome inhibitor-stimulated Nrf1 protein-dependent compensatory increase in proteasome subunit gene expression reduces polycomb group protein level.
22216197 2011 The Nrf1 CNC-bZIP protein is regulated by the proteasome and activated by hypoxia.
20935630 2010 Association analyses of 249,796 individuals reveal 18 new loci associated with body mass index.
20932482 2010 Proteasomal degradation is transcriptionally controlled by TCF11 via an ERAD-dependent feedback loop.
20385086 2010 Transcription factor Nrf1 mediates the proteasome recovery pathway after proteasome inhibition in mammalian cells.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
20102225 2010 Identification of bZIP interaction partners of viral proteins HBZ, MEQ, BZLF1, and K-bZIP using coiled-coil arrays.
17609210 2007 The p65 isoform of Nrf1 is a dominant negative inhibitor of ARE-mediated transcription.
16806233 2007 Identifying leukocyte gene expression patterns associated with plasma lipid levels in human subjects.
16687406 2006 Nrf1 is targeted to the endoplasmic reticulum membrane by an N-terminal transmembrane domain. Inhibition of nuclear translocation and transacting function.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12805554 2003 Comprehensive identification of human bZIP interactions with coiled-coil arrays.
12729924 2003 Cellular localisation and nuclear export of the human bZIP transcription factor TCF11.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12358155 2002 Screening the proteins that interact with calpain in a human heart cDNA library using a yeast two-hybrid system.
11025215 2000 Expression of the bZIP transcription factor TCF11 and its potential dimerization partners during development.
9872330 1998 Nrf2 and Nrf1 in association with Jun proteins regulate antioxidant response element-mediated expression and coordinated induction of genes encoding detoxifying enzymes.
9826775 1998 Nrf1 in a complex with fosB, c-jun, junD and ATF2 forms the AP1 component at the TNF alpha promoter in stimulated mast cells.
9501099 1998 Targeted disruption of the ubiquitous CNC-bZIP transcription factor, Nrf-1, results in anemia and embryonic lethality in mice.
9421508 1998 Interaction of the CNC-bZIP factor TCF11/LCR-F1/Nrf1 with MafG: binding-site selection and regulation of transcription.
9150357 1997 Human small Maf proteins form heterodimers with CNC family transcription factors and recognize the NF-E2 motif.
8932385 1996 Small Maf proteins interact with the human transcription factor TCF11/Nrf1/LCR-F1.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
8248256 1993 Cloning of Nrf1, an NF-E2-related transcription factor, by genetic selection in yeast.
8036168 1994 Cloning and functional characterization of LCR-F1: a bZIP transcription factor that activates erythroid-specific, human globin gene expression.
8001966 1994 Molecular cloning of a putative novel human bZIP transcription factor on chromosome 17q22.
7557987 1995 Structural organization and mapping of the human TCF11 gene.