Property Summary

NCBI Gene PubMed Count 60
PubMed Score 209.00
PubTator Score 202.04

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count P-value
non-small cell lung cancer 2799 4.4e-09
tuberculosis 1963 5.5e-07
osteosarcoma 7766 2.4e-06
hepatocellular carcinoma 536 1.2e-03
pancreatic cancer 2322 2.1e-03
pancreatic carcinoma 555 2.1e-03
Disease Target Count Z-score Confidence
Carcinoma 11192 0.0 0.5
Disease Target Count Z-score Confidence
Hemolytic anemia 73 0.0 2.0
Disease Target Count Z-score Confidence
Anemia 353 4.439 2.2
Polycythemia 25 3.518 1.8
Thrombocytopenia 193 3.502 1.8
Cancer 2388 3.148 1.6

Expression

  Differential Expression (6)

Disease log2 FC p
hepatocellular carcinoma 1.200 1.2e-03
non-small cell lung cancer -1.007 4.4e-09
osteosarcoma -6.263 2.4e-06
pancreatic cancer 1.400 2.1e-03
pancreatic carcinoma 1.400 2.1e-03
tuberculosis 2.900 5.5e-07

Gene RIF (34)

AA Sequence

MSPCPPQQSRNRVIQLSTSELGEMELTWQEIMSITELQGLNAPSEPSFEPQAPAPYLGPPPPTTYCPCSI      1 - 70
HPDSGFPLPPPPYELPASTSHVPDPPYSYGNMAIPVSKPLSLSGLLSEPLQDPLALLDIGLPAGPPKPQE     71 - 140
DPESDSGLSLNYSDAESLELEGTEAGRRRSEYVEMYPVEYPYSLMPNSLAHSNYTLPAAETPLALEPSSG    141 - 210
PVRAKPTARGEAGSRDERRALAMKIPFPTDKIVNLPVDDFNELLARYPLTESQLALVRDIRRRGKNKVAA    211 - 280
QNCRKRKLETIVQLERELERLTNERERLLRARGEADRTLEVMRQQLTELYRDIFQHLRDESGNSYSPEEY    281 - 350
ALQQAADGTIFLVPRGTKMEATD                                                   351 - 373
//

Text Mined References (60)

PMID Year Title